SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003751 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003751
Domain Number 1 Region: 5-32,84-153
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-23
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Domain Number 2 Region: 156-268
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-19
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003751   Gene: ENSOPRG00000004077   Transcript: ENSOPRT00000004072
Sequence length 389
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2921:79275:83988:1 gene:ENSOPRG00000004077 transcript:ENSOPRT00000004072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGTTLLALLALVLLYLVLGALVFQALEQPHEQQAQRGLGETQDKFLRDHLCVSQQELGQ
FVEEVATALGEGAEPGTNSSSNSSHSAWDLASAFFFSGTIITTIGYGNAALRTDAGRLFC
IFYALVGIPLFGILLAGVGDRLGSSLRRGIAHIEAIFLKWHVPPELVRVLSAMLFLLVGC
LLFVLTPTFVFCYMEKWSKLEAIYFVIVTLTTVGFGDYVAGAGPRQDFPAYQPLVWFWIL
LGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQAASWTGTVTARVTQRAGPATPQPEKE
RPPLPPALCPAQPPSPAPPEKTETPSPPTASALDYPGENLAFIDESSDTQSERGFAQPRT
VRGRRRPNPVRKPARPRGPARPRGKGVPV
Download sequence
Identical sequences ENSOPRP00000003751 ENSOPRP00000003751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]