SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003897 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003897
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily SRCR-like 4.58e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000776
Further Details:      
 
Domain Number 2 Region: 125-169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000236
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003897   Gene: ENSOPRG00000004219   Transcript: ENSOPRT00000004227
Sequence length 171
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5090:14341:18617:1 gene:ENSOPRG00000004219 transcript:ENSOPRT00000004227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGGSGPCSGRVEVLHQGAWGTVCDDLWDLNEAEVVCRQLRCGRAISSPGEAHFGPGSGDI
FLDNLQCTGVERALGQCAHLGWLEHNCGHHEDAGVICSDAEALPPTTAPXXXXXXXXXXX
XGSESCGGVLSSLSGSFSSPHYPESYPTDIQCVWEIHMKKQLRIQLMIPSL
Download sequence
Identical sequences ENSOPRP00000003897 ENSOPRP00000003897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]