SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004028 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004028
Domain Number 1 Region: 450-573
Classification Level Classification E-value
Superfamily Cadherin-like 3.93e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 231-354
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-28
Family Cadherin 0.0017
Further Details:      
 
Domain Number 3 Region: 344-454
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-19
Family Cadherin 0.006
Further Details:      
 
Domain Number 4 Region: 567-672
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000257
Family Cadherin 0.0033
Further Details:      
 
Domain Number 5 Region: 168-235
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000157
Family Cadherin 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004028   Gene: ENSOPRG00000004375   Transcript: ENSOPRT00000004369
Sequence length 1131
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4846:67530:81307:-1 gene:ENSOPRG00000004375 transcript:ENSOPRT00000004369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQMNTKMHFRFAFALLMASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENALHTYSLSNDF
IEVRTRTDGAKYAELIVVRELDRELKSSYELQLNASDMGVPQRSGSSILKISISDSNDNS
PAFEQQSYLIHLLEDSPVGTLLLELNATDPDEGANGKIVYSFSSHVSPKIIETFKIDSER
GHLTLFKQVDYELTKSYEIDVQAQDLGPNSIPAHCKIIIKVVDVNDNKPEININLMSPGK
EEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHGHFKLQKTYENNYLILTNATL
DRERRSEYSLTVIAEDKGTPSLSTVKHFTVQVNDINDNPPHFQRSRYEFVISENNSPGAY
ITTVTATDPDLGENGQVTYTILESFILGSSITTYVTIDPSNGAIYALRIFDHEEVSQITF
VVEARDGGSPKQLVSNTTVVLTIIDENDNVPVVIGPALRNDTAEISIPKGAESGFLVTRI
RAIDRDSGVNAELSCSIVAGNEENIFVIDPRTCDIHTNVSMESFPYTEWELAVIIQDKGN
PQLHTKVFLKCIIFEHAESVTSTAMTSVSQASLDVSMIIIISLGAICAVLLVIMVLFATR
CNREKKDTRSYNCRVAESTYQHHPKRPSRQIHKGDITLVPTINGTLPIRSHHRSSPSSSP
TLERGQMGSRQSHNSHQSLNSLVTISSNHVPENFSLELTHATPAVEXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXMRLCTEECRVLGHSDQCWMPPLPSPSSDYRSNMFIPGEEFPTQPPQQPA
HLSLDEEASPAECGGEKKKSFSTFGKDAPSDEDTADTSTSSLLSEMSSVFQGLLPPSLGT
FREGSDAKRANLLRRKGQLAAKGAGYLQSGASCLVTLLLMPTSSSGAALGAHSSVQPSSK
WLPAMEEIPENYEEDDFDNVLNHLSDGKHELMDASELVAEINKLLQDVRQS
Download sequence
Identical sequences ENSOPRP00000004028 ENSOPRP00000004028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]