SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004149 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004149
Domain Number 1 Region: 583-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000137
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 616-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000114
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 100-130
Classification Level Classification E-value
Superfamily SET domain 0.00000837
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 142-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000772
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004149   Gene: ENSOPRG00000004507   Transcript: ENSOPRT00000004508
Sequence length 713
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1243:50969:59318:1 gene:ENSOPRG00000004507 transcript:ENSOPRT00000004508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHAATRVPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVLANTTSVLCVR
MVRGELVDESGGSPLEWIGLIRAARNPQEQTLEAIADLPGGQIFYRALRDVQPGEELTVW
YSNSLAQWFDIPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVLSGGGGGAL
LQEHAARPSAAPADGLGLSPKAPGPEFAALTPAYPLRPRPQAPLPTQGCGAESIRREVSS
VPSVSSFHPGWRGLRKKGKEPDRALDFTSPAQVHDYFLYNEEASCVRLGFLNFYRGXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYCGKLYSRKYGLKIHMRT
HTGYKPLKCKVCLRAFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHP
GQSLLAKAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEAGGGCERDS
Download sequence
Identical sequences ENSOPRP00000004149 ENSOPRP00000004149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]