SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004966 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004966
Domain Number 1 Region: 2002-2161
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-30
Family YWTD domain 0.0000829
Further Details:      
 
Domain Number 2 Region: 1361-1480
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-22
Family YWTD domain 0.0000795
Further Details:      
 
Domain Number 3 Region: 376-483
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000000262
Family YWTD domain 0.0015
Further Details:      
 
Domain Number 4 Region: 1774-1867
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000034
Family YWTD domain 0.003
Further Details:      
 
Domain Number 5 Region: 4001-4103,4149-4177
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000497
Family YWTD domain 0.00091
Further Details:      
 
Domain Number 6 Region: 2353-2438
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000902
Family YWTD domain 0.0015
Further Details:      
 
Domain Number 7 Region: 566-633,681-767
Classification Level Classification E-value
Superfamily NHL repeat 0.0000000000759
Family NHL repeat 0.014
Further Details:      
 
Domain Number 8 Region: 3626-3663
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 914-958
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 10 Region: 2925-2966
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 11 Region: 3507-3544
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 12 Region: 3665-3701
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 13 Region: 878-917
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0004
Further Details:      
 
Domain Number 14 Region: 1001-1039
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000055
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 15 Region: 2794-2830
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000126
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 16 Region: 2837-2871
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 17 Region: 1040-1076
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00034
Further Details:      
 
Domain Number 18 Region: 3586-3621
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 19 Region: 2580-2621
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 20 Region: 3543-3583
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 21 Region: 192-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000599
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 22 Region: 2961-3009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000762
Family EGF-type module 0.014
Further Details:      
 
Domain Number 23 Region: 2621-2660
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000798
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 24 Region: 66-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 25 Region: 2753-2791
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 26 Region: 2674-2710
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000484
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 27 Region: 1210-1256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family EGF-type module 0.015
Further Details:      
 
Domain Number 28 Region: 2873-2914
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000864
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 29 Region: 3707-3744
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000864
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 30 Region: 2545-2582
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 31 Region: 3003-3038
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000359
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 32 Region: 1170-1205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000484
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 33 Region: 3354-3385
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000733
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 34 Region: 4419-4461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family EGF-type module 0.042
Further Details:      
 
Domain Number 35 Region: 4321-4356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000194
Family EGF-type module 0.026
Further Details:      
 
Domain Number 36 Region: 3879-3914
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000437
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 37 Region: 1611-1681
Classification Level Classification E-value
Superfamily YWTD domain 0.0000706
Family YWTD domain 0.005
Further Details:      
 
Domain Number 38 Region: 161-202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000758
Family EGF-type module 0.031
Further Details:      
 
Domain Number 39 Region: 1144-1167
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000759
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000004966
Domain Number - Region: 4285-4320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000144
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 1259-1292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00176
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 4256-4283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00221
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 2499-2560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0135
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004966   Gene: ENSOPRG00000005286   Transcript: ENSOPRT00000005407
Sequence length 4586
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3864:101262:1148268:-1 gene:ENSOPRG00000005286 transcript:ENSOPRT00000005407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLDSGLRAVAAAAAGAGPRVPASSLQRRLTYRAPTMSELLLAFLTLSGLLPIARVLTM
GAQRDQHLCDPGEFLCHDHVTCISQSWLCDGDPDCPDDSDESLDAXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLSNCQQLNCQYKCAVARNSTRCYCEAG
FEVKDDGRGCKDQDECAVYGTCSQTCINTYGSYVCSCVEGYIIQPDNRSCKAKHEPTERP
PMLLIANSETIEIFYLNGSKLATLSSVNGNEIHALNFIYNEDMICWIESRESSYQLKCIQ
ITKTGKLTDEWTIHILQSFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXKLFFTDYGNIAKVERCDMDGMNRTRIIDSKQEQPAAMALDSGNKL
VYWVDLYLDYVGVVDQGKNRHTVIQGRQVRHLCGITVFEDYLYAITSDNFNIIKINRFNG
TDNHSLIKIESARGIRIYQKRTQPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXPKNELFLFYGKGRPGIVRGMDLNTKIAEEYMIPIENLVNPRALDFH
ADTNYIYFADTTSFLIGRQKIDGTERETILKDXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWMYWTDWEEDEIDDSVGRIEKAWMDGF
NRQIFVTSKMLWPNGLTLDFHTNTLYWCDAYYDHIEKVFLNGTHRKXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPGEILPPICKAGEFRCKNRHCIQARWKC
DGDDDCLDGSDEDPANCFNHSCPDDQFKCHNNRCIPKRWLCDGANDCGSNEDESNETCSX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFPTCEPLTQFICKNGRCISSK
WHCDSDDDCGDGSDEVGCVHSCLENQFRCSTGRCIPGHWACDGDNDCGDFSDENQSNCTQ
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXRCINKAWVCDGDIDCEDQSDEEDCDSFLCGPPKYPCANDTSVCLQPEKLCNGKRDCP
DGSDEGSLCDECSLSNGGCSNHCSVVPGRGIVCSCPEGLQLNKDNKTCEIVDYCTYHLKC
SQVCEQHKHTVKCSCYEGWKLDVDGESCTSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTAIEVVVEHGLATPEGLTVDW
IAGNIYWIDSNLDQIEVAKLDGSLRTTLIAGAMEHPRAIALDPRYGILFWTDWDANFPRI
ESASMSGAGRKTIYKDMKTGAWPNGLTVDHFEKRIVWTDAXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKFLLYARRSEI
RGVDIDNPYFNFITAFTVPDIDDVTVIDFDAYEERLYWTDVKTQTIKRAFINGTGLQTVI
SRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSIDYVENKLYWISSGNGTINRCNLDG
GNLEVIESMKEELTKATALTIMDKKLWWADQNLGQLGTCSKRDGRNLTILRNKTSGVVHM
KVYDKEAQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIESFLMYS
VHEGIRGIPLEPSDKMDALMPISGTSFAVGIDFHAXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXNIYWTDHGFNLIEVARLNGSFRYVIISQGLDQPRSIAVH
PEKGFLFWTEWGQMPCIGKARLDGSEKVILVSMGIAWPNGISIDYEENKLYWCDARTDKI
ERIDLETGGNREVVLSGSNVDMFSVAVFGAYIYWSDRAHANGSIRRGHKNDATEIVTMRT
GLGVNLKEVKVFNRVREKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXHPHVLALDECQNLMFWTNWNEQYPSIMRSTLSGKNAQVVISTDILTP
NGLTIDHRTEKLYFSDGSLGKIERCEYDGSQRHXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELSPCALLNGGCHDLCLLTPDG
RVNCSCRGDRILLDDNRCVIKNSSCNVYSEFECGNGECIDYQLTCDGAPHCKDKSDEKLL
YCENRSCRRGFKPCYNRKCISHSKLCDGENDCGDNSDELDCKVSTCATVEFRCADGTCIP
RSARCNQNIDCADASDEKNCNNTDCTHFYKLGVKTSGFIKCNSTSLCILPTWICDGSNDC
GDYSDELKCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSCSWNQF
ACSAHKCISKHWICDGENDCEDGLDENDNICGAITCAADMFNCQGSHACVPRQWLCDGER
DCPNGSDELSTAGCAPNNTCNENTFMCRNKVCIPKQFVCDHDDDCGDGSDESLQCGYRQC
SAEEFSCADGRCLLNSQWQCDGDFDCPDHSDEAPLNPKCNSAEQSCNSSFFMCKNGRCIP
SGALCDNKDDCGDGSDERNCHVNECLSKKISGCSQDCQDLPVSYKCKCWPGFQLKDDGRT
CVDIDECSTGFPCSQQCINTYGTYKCLCTDGYAAQPDNPNGCKSLAXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXGLNNVIAIDFDYREEFVYWIDSSRPNGSRINRMYLNGSDVKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFRCK
TDKCIPFWWKCDTVDDCGDGSDEPDDCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXPVNLRCNGQDDCDEEDERDCPENSCSPDYFQCKXX
XXXXXXXXXXXXXXXXXXXXXXXXXXKKTCGPHEFQCKNNNCIPDHWRCDSQNDCSDNSD
EENCKPQTCTLKDFLCANGDCVSSRFWCDGDFDCADGSDERNCETSCSKDQFQCSNGQCI
SAQWKCDRHEDCKYGEDEKNCEPASPTCSSSEYICASGRCISASLKCNGEYDCADGSDEM
DCVTECHEDQFRCKNKAHCIPIRWLCDGIHDCVDGSDEENCDRGGNICRTDEFLCNNSLC
KLHFWVCDGQDDCGDNSDEDPDMCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNECLVFGTCSHLCINTEGSYK
CVCDHNFQEKNNTCIAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCPEFKRPRDIAVDWVAGNIYWT
DHSRMHWFSYYTTHWTSLRYSINVGQVNGPNCTRLLTNMAGEPYAIAVNPKRGMMYWTVI
GDHSHIEEAAMDGTLRRILVQKNLQRPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXLLHPHRIDIFEDYIYGAGPKSGVFRVQKFGHGSVEFLALDVDKTKGVLISHR
YKQLDLPNPCLDLACEFLCLLNPSGATCVCPEGKHWSNGTCRDANLLDDSCKLGENGGRC
ILNEEGDLRCHCWPSYSGERCEVNHCSNYCQNGGTCTPSTLGRPTCTCALGYTGPSCGKT
VCEAFCQNGGTCVVTAGNQPHCHCLPEYTGDRCQYYVCHXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCTNGKIASSCQLCDGYCYNGGTCQLD
PETSVPVCLCSTNWSGTQCERPAPKSSKSDHISTRSIAIIVPLVLLVTLITTLVIGLVLC
RRKRRTKTIRRQPIINGGINVEIGNPSYNMYEVDHDHNDGGLLDRGFMIDTTKARYRGGG
PSAFKLPHTAPPIYLNSDLKGPLTAG
Download sequence
Identical sequences ENSOPRP00000004966 ENSOPRP00000004966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]