SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004971 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004971
Domain Number 1 Region: 440-511
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.12e-16
Family EF-G/eEF-2 domains III and V 0.013
Further Details:      
 
Domain Number 2 Region: 234-331
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000353
Family Elongation factors 0.0075
Further Details:      
 
Domain Number 3 Region: 357-403
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000147
Family EF-G/eEF-2 domains III and V 0.0086
Further Details:      
 
Domain Number 4 Region: 157-256
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000367
Family G proteins 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004971   Gene: ENSOPRG00000005400   Transcript: ENSOPRT00000005413
Sequence length 592
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4318:106373:123581:1 gene:ENSOPRG00000005400 transcript:ENSOPRT00000005413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTVVGRGCWRGRLQVPRVTMAPRPPAAGSWATHRRCCSADVEXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIQAQTVANFFLAFEAQLAIIPV
INKIDLKNADPERVEKQIEKVGDIPRNECIKXXXXXXXXXXXXXXXXXXXXXXPKVQRKN
PLKALVFDSTFDRYRGVIASVALFDGIVSKGDKIVSAHTQKTYENEVGVLNPSERSTQKL
YAGQVGYLIAGMRTVSEAQVGDTLYLHRQPVEPLPGFKAAKPMVFALALDEELINVTVHR
NSSLALGAGWRLGFLGLLHMEVFNQRLEQEYNASVILTTPTVPYKAVLSSAKLIKEHREK
EITIINPAQFPDKSKVTEYLEPVVLGTIITPDEYTREIMMLCQARRAVQKNMMFIDQNRV
MLKYLFPLNEIVVDFYDSLKSLSSGYASFDYDAGLPSAELCMDXXXXXXXXXXXXXXXXX
DKAYSVGKTICERLKDSLPRQLFEIAIQAAIGSKIIARETVKPYRKNVLGKC
Download sequence
Identical sequences ENSOPRP00000004971 ENSOPRP00000004971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]