SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005412 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005412
Domain Number 1 Region: 210-333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-17
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 128-250
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000121
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 568-719
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000484
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 6-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000487
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 787-835
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000262
Family Spermadhesin, CUB domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005412   Gene: ENSOPRG00000005889   Transcript: ENSOPRT00000005893
Sequence length 836
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3297:1184:72626:-1 gene:ENSOPRG00000005889 transcript:ENSOPRT00000005893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDECENDYYNGGCVHECINIPGNYRCTCFDGFMLAHDGHNCLDVDECQDNNGGCQQICVN
AMGSYECQCHSGFFLSDNQHTCIHRSSEGMSCMNKEHGCAHICRETPKGGVACDCRPGFD
LAPNQKDCTLTCNYGNGGCQHSCEDTDTGPTCGCHQKYSLHSDGRTCIETCAVNNGGCDR
TCKDTATGVRCSCPVGFTLQPDGKTCKDINECLANNGGCDHFCRNTVGSFECGCRKGYKL
LTDERTCQDIDECSFERTCDHVCVNSPGGFQCLCHGGYALYGTAHCGDVDECSMDNGGCD
EGCVNTKGSYECVCPPGKRLHWNRKDCLEMGKCLSRAQSTQAQLSCSKAGGVERCLLSCP
AHSLFLPDSENSYLLGCGSPGLQGKAPPRRNGTSPGPGPGCSDAPGTPIKQKARFKIRDA
KCHLKPRSQDPTRAMSQQLLLXXXHVTSVTLKCDSTKKRRRGRKSPSKEVSHITAEFEVE
AKLDEASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXACRPGSYFSGESSQCVPCAPGTYQNLEGQLSCTPCPSSDGLGLA
GARNVSECGGQCPPGFFSTDGFKPCQACPVGTYQPEPGRTSCFPCGGGLLTKQEGTVSFQ
DCETKVHCSPGHYYNTNTHRCIRCPVGTYQPEFSQNHCLTCPGNTSTDFDGSTNVTHCKX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXSPTSVTTYETCQTYERPIAFTSRSRKLWVQFKSNEGNSGKGFQVPYVTYD
Download sequence
Identical sequences ENSOPRP00000005412 ENSOPRP00000005412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]