SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005510 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005510
Domain Number 1 Region: 475-600
Classification Level Classification E-value
Superfamily Cadherin-like 1.21e-29
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 233-358
Classification Level Classification E-value
Superfamily Cadherin-like 5.86e-25
Family Cadherin 0.0014
Further Details:      
 
Domain Number 3 Region: 123-247
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-20
Family Cadherin 0.0025
Further Details:      
 
Domain Number 4 Region: 593-697
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000005
Family Cadherin 0.0026
Further Details:      
 
Domain Number 5 Region: 406-487
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000157
Family Cadherin 0.0069
Further Details:      
 
Domain Number 6 Region: 29-123
Classification Level Classification E-value
Superfamily Cadherin-like 0.00002
Family Cadherin 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005510   Gene: ENSOPRG00000005994   Transcript: ENSOPRT00000006000
Sequence length 1043
Comment pep:known_by_projection scaffold:pika:scaffold_390:48865:52758:-1 gene:ENSOPRG00000005994 transcript:ENSOPRT00000006000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAKRWGRPLLFPLQLFSLCWVLSVAQSKTVRYSTFEEDAPGTVIGTLAEDLHMKVSGD
TSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH
VEVEVRDVNDHAPLFPRAQIPVEVSEGAAVGTRIPLEVPVDEDVGANGLQSVRLAEPHSP
FRVELQTRADGAQCADLVLLQELDRESQAAYSLELVAQDGGRPPRSATAALSVRVLDAND
HSPAFPQGAVAEVELAEDAPVGSLLLDLDAADPDEGPNGDVVFSFGARTPPEARRLFRLD
PRSGRLTLAGPVDYERQDTYELDVRAQDRGPGPRASTCKVIVRIRDVNDNPPDITITPLA
APGAPPASAFTAAAALGADATSPAGPGTPDAGTTSLVPGAARESLALVSTSDDSGANGQV
RCALYGHEHFLQQYGSYLVVTAASLDRERIAEYNLTLVAEDRGSPPLRTVRPYTVRVGDE
NDNAPVFTRPVYEVSVRENNPPGAYLATVAARDPDLGRNGQVTYRLLDAEVGRAGGAVST
YVSVDPATGAIYALRSFDYETLRQLDVRIQASDGGSPQLSSSALVQVRVLDQNDHAPVLV
LPVPANGTLEVAVPGRTARDTAVARVQARDADEGANGELAFDLQQQEPREAFTIGRRTGE
IVLTGILSQEPPGSVFRALLVISDGGRPLLATSVLVSCVLTAGGGGPRLGASGPRLLQWD
TPLIVIIVLAGSCTLLLAAIIAIATTCNRRKKEVRKGGALREERPGAAGGGASAPGSPEE
AARGAGPRPNMFDVLTFPGSGKAPFGSPAADAPPPAVAAAEVPGSEGGSATGESACHLEG
QQRLRGAHAEPYGASPGFGKESAPAVTDWKGHSFNTISGREAEKFSGKDSGKGDSDFNDS
DSDISGDALKKDLINHMQSGLWACTAECKILGHSDRCWSPSCGGPNAQPALQPPAQMSTF
CKSTSLPRDPLRRDNFYQAQLPKTVGLQSVYEKVLHRDYDRTVTLLSPPRPGRLPDLQEI
GVPLYPSPPGRYLSPKKGADENV
Download sequence
Identical sequences ENSOPRP00000005510 ENSOPRP00000005510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]