SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005704 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005704
Domain Number 1 Region: 46-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.51e-36
Family SCAN domain 0.0000636
Further Details:      
 
Domain Number 2 Region: 955-1011
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 870-927
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 756-807
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000126
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 5 Region: 687-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000107
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 917-948
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000789
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005704   Gene: ENSOPRG00000006227   Transcript: ENSOPRT00000006220
Sequence length 1030
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3315:235183:253243:1 gene:ENSOPRG00000006227 transcript:ENSOPRT00000006220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVVLDSRSQASPPPEPEDLLIVKLEEDSWDSEPKLLERHHEPVPGPEASRRRFRQFQYR
DAAGPHEAFSQLWALCCRWLRPEIRLKEQILELLVLEQFLTILPREVQTWVQARHPESGE
EAVALVEDWHREARAAGRRELELCAKEAKSLKAVRESQSFQLQAVDHWPEGSSQKQWMKN
SCRDVPKHLNPKMAPQPLKESAILTPQVPALPKVGSVGDWEVTVESQEALGPGKQVEKEF
CEDTVGDDCGDHVCLGVPVSKASITSQQEQGSEFWGLSLVNSTKRNSADDILDNEQTKAA
PALAWKDSKAWEEQCQWDVEDMKVSGVHWGYEETKTFLAILSESPFSEKLRTCHQNRQVY
RAIAERLRARGFLRTLEQCRYRVKNLLRNYRKAKSSHPPGTCPFYEELEALVRSRMTVRA
TGGPGEAMALPRLGDSDAEMDEQEERGWEPEETAECCNGAGPATDESSQGHKISGHPTLL
QSRIAGVHWGYEETKAFLAILSESPFSEKLRTCHQNSQVYRAIAERLCALGFLRTLEQCR
YRFKNLLRSYRKAKSSHPPGTCPFYEELDSLMRARIAVRALGAVRESTGGHWRLSVEVWG
EVAGGDAMRAKTPDTGFEMRCEDEDETWEQDILEESPGHLSQCIPDAVCRAHDWGEDSDH
ENSGEGELEDPPEEQWEECSSEEDLEKLIDHRVLYLAEKPYKSDTCVKSFSRSSHFLAHQ
QVHTNEKAHKRLVCGKGFHDCSDLSTYQGLHTGQQPYKCLEYEQSFSDHSSWVTHQRIHV
GEKPHQCGECWESFNQSSNLLKHQRVHWGGDPEQRSEPGERLGRSPSRSAHWRSSTGKTT
PEEAPSSRKSLPPSTRLEEKLYQCSECGRSFSKSSALISHQRIHTGEKPYECGKCGKSFS
KSSTLANHQRTHTGEKPYKCVDCGKCFSERSKLITHQRVHTGEKPYKCLECGKFFRDRSN
LITHQRIHTGEKPYRCRECGKCFNQSSSLIIHQRTHTGEKPYKCTECGKDFNNSSHFSAH
RRTHTAGKAS
Download sequence
Identical sequences ENSOPRP00000005704 ENSOPRP00000005704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]