SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005706 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005706
Domain Number 1 Region: 1125-1254
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-30
Family Cadherin 0.00088
Further Details:      
 
Domain Number 2 Region: 3316-3427
Classification Level Classification E-value
Superfamily Cadherin-like 2.3e-28
Family Cadherin 0.00085
Further Details:      
 
Domain Number 3 Region: 2264-2370
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-28
Family Cadherin 0.0012
Further Details:      
 
Domain Number 4 Region: 2791-2899
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 5 Region: 1018-1135
Classification Level Classification E-value
Superfamily Cadherin-like 1.15e-24
Family Cadherin 0.00065
Further Details:      
 
Domain Number 6 Region: 3415-3533
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-23
Family Cadherin 0.0021
Further Details:      
 
Domain Number 7 Region: 814-917
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-23
Family Cadherin 0.00098
Further Details:      
 
Domain Number 8 Region: 446-544
Classification Level Classification E-value
Superfamily Cadherin-like 7e-23
Family Cadherin 0.00088
Further Details:      
 
Domain Number 9 Region: 708-820
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 10 Region: 919-1022
Classification Level Classification E-value
Superfamily Cadherin-like 5e-21
Family Cadherin 0.0024
Further Details:      
 
Domain Number 11 Region: 2474-2584
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-21
Family Cadherin 0.0024
Further Details:      
 
Domain Number 12 Region: 1230-1364
Classification Level Classification E-value
Superfamily Cadherin-like 9.92e-21
Family Cadherin 0.003
Further Details:      
 
Domain Number 13 Region: 136-226
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 14 Region: 2901-3012
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-19
Family Cadherin 0.0031
Further Details:      
 
Domain Number 15 Region: 2371-2469
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-18
Family Cadherin 0.002
Further Details:      
 
Domain Number 16 Region: 2572-2681
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-16
Family Cadherin 0.0033
Further Details:      
 
Domain Number 17 Region: 2688-2798
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000528
Family Cadherin 0.0021
Further Details:      
 
Domain Number 18 Region: 3000-3063
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000771
Family Cadherin 0.0015
Further Details:      
 
Domain Number 19 Region: 557-658
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000968
Family Cadherin 0.0021
Further Details:      
 
Domain Number 20 Region: 3145-3209
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000011
Family Cadherin 0.0061
Further Details:      
 
Domain Number 21 Region: 3214-3314
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000343
Family Cadherin 0.0043
Further Details:      
 
Domain Number 22 Region: 361-458
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000171
Family Cadherin 0.0096
Further Details:      
 
Domain Number 23 Region: 32-148
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000214
Family Cadherin 0.0028
Further Details:      
 
Domain Number 24 Region: 3529-3620
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000228
Family Cadherin 0.02
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000005706
Domain Number - Region: 3766-3815
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00145
Family Laminin G-like module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005706   Gene: ENSOPRG00000006215   Transcript: ENSOPRT00000006222
Sequence length 4351
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5200:315946:368688:-1 gene:ENSOPRG00000006215 transcript:ENSOPRT00000006222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIAFLGLAIYLLHCATCEKPLEGILSSSAWHFTHSLYNATIYENSAPKTYVESSVKMGV
YLADPQWTVRYRIISGDVANVFKTEEYVVGNFCFLRIRTKSSNTALLNREVRDSYTLIIQ
ATEKTLELEALARVVVHILDQNDLKPLFSPPSYRVTIPEDIHPRSSICKVTATDADLGQN
AEFYYTFNTRSEAFAIHPTSGVVTVAGKLNATWQGKYELQVLAVDRMRKISEGKGFGNMA
ALVIHVEPALRKPPAIVSVAMTPPGDNEDITYATVVVNTDDSGTAVESVEVVGGDPGKHF
KAIKSYAQSNEFNLVAIKDINWIEHQQGFNLSLQATGGGRSPSHSPPWGFHLPASALVSL
RFEKTTYRVQLSEFAPPGSRVVRVRVTPAFPNLQYVLKPSPGSTEFRLNTRTGLITTTRF
MDVHDGTHYQLHVRTTLGLASTVVIIDIMDCNNHAPIFNRSSYEGTLDENIPPGTSVLAV
TATDLDPGENGFITYSITGPKGVPFSIDPYLGIISTSKPMDYELMRRVYTFRVRASDWGS
PFRREKEVSISLRLQNLNDNQPMFEDVNCTGSIGRDWPVGKSVMTMSAIDVDELQNLRYE
IVSGNELDNFDIHHFSGVVSLKRSLINLTVGQPTSYSLKITASDGKNYASPTTLNLTVVK
DPRFEVPVTCDKTGVLAHFTKTILHSVGLQNQESNEDEFMSFSMYQANRHPPQFEDHFPQ
SIDILERVPIDTPLARLAATDPDADFNGKLVYVIADGNEEGCFDIELETGLLSVAALLDY
ETTSFYILNITVYDLGTPQKSSWKLLTVNVKDWNDNAPRFPPGGYQLTISENTDVGTTIA
VLKTEDADSEDNGRVRYSLLSPTEKFSLHPLTGELVVTGPLDRESEPQHVLKVEARDQPR
KGHQLFSVTDLIVTLEDTNDNSPQCITEFSSLKVPEDLPPGTILAFLDASDPDLGSAGEV
RYVLLDDAHGTFRVDVTTGALSLERELDFERRAGYNLSLWASDSGKPVARKTLCHVEVIV
LDVNENLHPPRFASFVHQGQVQENSPSGTPVLLVAAHDDDSGLDGELQYFLRAGTGLAAF
SINQDTGMIQTLAPLDREFAPFYWLTVLAVDRGSVALSAVTEVYIEVTDANDNPPRMSRP
VFYTSILEGVPVGTSVLQLEAWDPDSSSKGKLTFNITGGDHMGFFSIHPFTGLLSSARQL
DRENKEEHILEVTVLDNGEPTLKSTSRVVVHILDVNDNPPVFSHKLFKVRLPEKLSPASP
APVYRLVASDLDEGLNGKISYSIEESEEEGFSIDPTGVVSSSSIFAAGEYNILTIKATDS
GEPPLSASVRLHIEWIPTPRPSSMPLVFEETHYSFTVMETDPVNHMVGVISVEGRPGLFW
FNISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXTDTALGSFSEATVEVLVEDINDNAPTFSQLVYTTSV
SEGLPAQTPVIQLLASDQDSGQNRDVSYHIVEDGSDVSKFFQINGSTGELSTVRELDYEA
QQHFHVKVRAMDRGDPPLTGETLVVVNVSDVNDNPPEFRQPQYEANVSELATCGHLVLKV
QALDPDSQDTSNLEYLILSGNQDRHFTINSSSGIISMFNLCKKQLDSFYNLRVGASDGVF
RATVPVYINTTNANKYSPEFQQHVYEAELAENAKVGTKVIELLAIDKDSGPYGTVDYTII
NKLAGEKFSINPTGQIATLQKLDRENSTERVIAIKVMARDGGGRVAFCTVKIILTDENDN
APQFKASGYTVSIPSNVSKDSPVIQVLAYDADEGRNADVTYSVDSMEDLAEEIIEVNPIT
GVVKVKESLVGLENQAFDFKIKAQDGGPPHWDSHVPVRLQVVPNEVALPKFSEPLYSFSA
SEDLQEGSEIGFVKAVAAQDPIIYSLVQGTTPESNKDGVFSLDQDTGVLKVKKALDHEST
KWYQIDLMAHCPHEDTDLVSLVSVNIQVKDVNDNRPVFEADPYKAFLTENMPGGTTVIQV
TANDQDTGNDGRVSYRLSSDAGNNIHELFAIDSETGWITTLQELDCETRQNYQFHVVAYD
HGQTIQLSSQALVEVSVTDENDNAPRFAATDYRGSVVENSEPGELVVTLKTLDADISEKN
RQVTCYITEGDPLGQFGISQVGDEWRISSRKILDREHMAKYLLRITASDGKFQTSVPVEV
FVLDINDNSPQCSQLVYTGKVQEDVPPGHFILKVSATDMDTDTNAQITYSLHGPGAHEFK
MDPHTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXINAQVVYSLTDSAEGHFSIDATTGVIRLEKPLRART
QAALELTVRASDLGTPIPLSTLGTVTVSVVGLEDYLPVFLSPEHGIRVREDTPLGTEVLH
LAPLTRPGSEKSGYSVVSGNEQGSFRLDTRTGILYVNGSYDVGKSPKYXXXXXXXXXXSS
ALSDTITVVVNVTDINEHRPRFPQELYGLKVLENAMVGDVVFTVTATDADGPLNSAITYS
LVEGDQLGHFTIHPKKGELQVARALDWEQTPSYSLKLRATDSGQPPLHEDTDVAIQVVDV
NDNPPRFFQLNYSTTIQENSPIGSKVLELILSDPDSPQNGPPYSFQITKGNTGSAFRVTP
DGWLVTTMGLSRRLQEWYQLHIEVSDSGIPPLSSSTLVSIHVTEQSQYPPSALPLEIFIT
IGEEEFQGGMVGKIHATDQDPQDTLTYRLAEEETLGSRFSVGTPDGKIIAMQGLPPGRYS
FNVTVSDGTFSTVAGVHVHVWHMGREVQQPAVWMGFHQLTPEELVSDHWRNLQRFLSNKL
DIRRANIHLASLQPAEAAAGVDVLLVFEGHTGTFYKLQELAAIITRSAKEMEHAVGIQMR
SAMPVVPCQGPSCQGQGCQETVHLDPEVGPTYSTARLSILTPRHRLEQNCSCNGTAASFR
GQSYVRYRPPEAQNWHIHFYLKTLQSQAVLLVTNETASISLKXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPGGATVWPPTYSRKERWEYPHADAT
QGPPQPSLHRHSTPAALMPEPAGLYGGFPFPLEMENKRAPLPPRYSNQNLEDLLPPRPPS
PREHLLAPCLNEYTAISYYHSQVRQAGAGPCLAEGGYKGVSMRLSRAGPSYAHCEGEGPP
PAVRGHPRNPPNYAGSDMVESDYGSCEEVMF
Download sequence
Identical sequences ENSOPRP00000005706 ENSOPRP00000005706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]