SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005885 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005885
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.24e-44
Family Proteasome subunits 0.000000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005885   Gene: ENSOPRG00000006425   Transcript: ENSOPRT00000006420
Sequence length 167
Comment pep:known_by_projection scaffold:pika:scaffold_25475:5963:14150:-1 gene:ENSOPRG00000006425 transcript:ENSOPRT00000006420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYV
YNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPL
TLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD
Download sequence
Identical sequences ENSOPRP00000005885 ENSOPRP00000005885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]