SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006344 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006344
Domain Number 1 Region: 226-348
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-31
Family Cadherin 0.0014
Further Details:      
 
Domain Number 2 Region: 441-567
Classification Level Classification E-value
Superfamily Cadherin-like 7.2e-29
Family Cadherin 0.0021
Further Details:      
 
Domain Number 3 Region: 123-230
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-22
Family Cadherin 0.0063
Further Details:      
 
Domain Number 4 Region: 340-445
Classification Level Classification E-value
Superfamily Cadherin-like 4.58e-21
Family Cadherin 0.007
Further Details:      
 
Domain Number 5 Region: 556-661
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-18
Family Cadherin 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000006344
Domain Number - Region: 25-115
Classification Level Classification E-value
Superfamily Cadherin-like 0.000228
Family Cadherin 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006344   Gene: ENSOPRG00000006923   Transcript: ENSOPRT00000006926
Sequence length 1147
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3653:4321:70157:-1 gene:ENSOPRG00000006923 transcript:ENSOPRT00000006926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLLLPVLLLSAVLWTQAAALINLKYSVEEEQRAGTVIANVAKDAREAGFALDPRQASA
FRVVSNSAPHLVDINPSSGLLITKQKIDRDLLCRQSPKCIISLEVMSSSMEICVIKVEIK
DLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTYELTPNELFGLEIKT
RGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPHLGTVGLSIKVTDSNDNNPVFGE
STYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRELFQIDPHSGLVTV
TGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLDTNDNPPVINLLSVNSELVEVSE
SAPPGYVIALVRVSDRDSGLNGRVQCRLLGNVPFRLQEYESFSTILVDGRLDREQHDQYN
LTIQARDGGVPMLQSAKSFTVRITDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDP
DLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQTKAFEFKVLAKDGGL
PSLQSNATVRVIILDVNDNTPVITAPPLINGTAEVYPRNSGIGYLVTVVKADDYDESENG
RVTYDMTEGDRGFFEIDQINGEVRTTRTFNENSKASYELIVVAHDHGKTSLSASALVLIY
LSPALDAQESMGSVNLSLIFIIALGSIAGILFVTMIFVAIKCKRDNKEIRTYNCXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIAEYSYGHQKKSSKKKKI
SKNDIRLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTR
NTSANHIYHHSFNSQGPQQPDLIINGVPLPETENYSFDSNYVNSRAHLIKSSSTFKDLEG
NSLKDSGHEESDQTDSEHDVQRSLYCVHAVNDVLNTSVTSMGSQMPDHDQNEGFHCREEC
RILGHSDRCWMPRNPMPTRSKSPEHVRNIIALSIEATAADVEAYDDCGPTKRTFATFGKD
VSDHPTEERPTVKGKRTVDVTICSPKVNGAIREAGNGCEAISPITSPLHLKSPLPTKPSV
SYTIALAPQARDLEQYVNNANNGPSRLSEAEPRGADSEKVIHEVNPILKEGRDKESPGVK
RLKDIVL
Download sequence
Identical sequences ENSOPRP00000006344 ENSOPRP00000006344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]