SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006494 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006494
Domain Number 1 Region: 3-17,47-281
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 7.85e-74
Family Inorganic pyrophosphatase 0.000000767
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006494   Gene: ENSOPRG00000007086   Transcript: ENSOPRT00000007090
Sequence length 296
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3606:47419:178274:-1 gene:ENSOPRG00000007086 transcript:ENSOPRT00000007090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVAGHYISPFHDIPLRVEPKQNTKAEGFINLSKTWENGIPTKKARNDEYENLFNMVVEVP
RWTNAKMEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPQTWEDPGQTDEST
NCCGDNDPIDVCEIGSKVLTRGEVIPVKILGILALIDESETDWKLIAINANDPDASKFDD
IDDVKKFKPGYLEATLNWFRYYKVPDGKPENQFAFNGEFRNKAFALEIIKSTHDHWKALL
MKKCDGGAINCTNVQVCDSPFLCTPEEARSFVESKLSSSWNKENSEEEEIWDFLGK
Download sequence
Identical sequences ENSOPRP00000006494 ENSOPRP00000006494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]