SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006597 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006597
Domain Number 1 Region: 1369-1536
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 1.39e-48
Family Crystallins/Ca-binding development proteins 0.00026
Further Details:      
 
Domain Number 2 Region: 1171-1356
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 2.35e-48
Family Crystallins/Ca-binding development proteins 0.0000506
Further Details:      
 
Domain Number 3 Region: 996-1158
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 4.83e-38
Family Crystallins/Ca-binding development proteins 0.0023
Further Details:      
 
Domain Number 4 Region: 1537-1669
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.06e-19
Family Ricin B-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006597   Gene: ENSOPRG00000007189   Transcript: ENSOPRT00000007204
Sequence length 1676
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1248:104477:166506:1 gene:ENSOPRG00000007189 transcript:ENSOPRT00000007204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKRSGGRRSGRRRRSQKSTDSPGADVAIPESAGRDDAVFDDEVAPNAAAESLSAEKKVK
SPRAAPDGGVASAGSPESKASPSPKGQLRGEPDRSKQPLPASSPTKRKGRSRAPESVPTA
PGSVLRAAAKESVPKKSPTLDPSPAAKGAAAENAEEAARVIPRELTVKSSSLLPEIKPEH
KRGPLPNHLDGRSRESPAGRGAADAEGLKARSHLGAGRSTVTTKVTLXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXNLAKKAKEMEHPEKKGAPTSSQNGVPEKEMPTEPLVSVPGEEGARGPRLGGKTVSHP
SGPPAPSSTKDQGPPSEEAPQAADSESRDRTSGAAQGRPAITDTKDLPATTIPGPQDEAS
ASQPPAESSHDPSLPRPGDIPSDTCSQVPLTNSLHTELEVTESRDGGTVPVSHHNGDKVP
PPELGGGEANPPLSPEPEGKGGPSRVLVRSFVLPVDSARDVSSHLLSGSSEVREVQLPSC
HNNELEVVSVTSCNPQQEEIPDNESPSPTQTPCRGEHVAESDPQVSLPNSETAVPAVQAQ
SQGERTPVRVEASPVPRPGGEAMNGQDSPARLLNVSADSDDSVFDSSSDMEKFTEIIKNL
DSTVCLPQKKKKGRPPHSPAPRFAMPPIHEDNGEVFDPXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCSSWSLSPVILIKVVRGCWILYE
KPNFEGNSIPLEEGELELSGLWGVEDILERNEEEESASKPVVIGSIRHVVQDYRISQIDL
FTEPEGLGILSSYFDDTEEMQGFGVMHKTCSIKVHWGTRLIYEEPGFQGVPFVLEPGEYP
DLSFWDTEEAYIGSMRPLKMGGRKVEFPTDPKVIIYEKPFFEGKCVELETEMCSILTEEG
ETGETTGDDCLPLASVGSMKVLRGIWVAYEKPGFTGHQYLLEEGEYKDWNDWGGYDGELQ
SLRPILGDFSNAHMIMYSEKNFGSKGSSIDVLGIVANLKETGYGVKTQSINVLSGVWVAY
ENPDFTGEQYVLDKGFYTTFEDWGGRNCKISSVQPISLDSFNGPRRRNQIHLFSEPQFQG
HSQTFEETTSQIEDSFSTKSCRVLGGSWVAYDGENFSGNQYVLEEGHYPCLSAMGCLPGA
TFKSLRFIDVEFSEPTIILFERENFKGKKIELNAETVNLRSLGFSTQIRSVQVIGGIWVT
YEFGNYRGRQFLLSPAEVCNWYEFSGCRQIGSLRPFIQKRIYFRLRNKATGLFMSTNGNL
EDLKLLRVQVMEDVGADDQIWVYQEGCIKCRIAEDCCLTIVGSLVTSGSKLGLALDQNAE
SQFWCMKSDGRIYSKLKPNLVLDIKGGAQYDQNHIILNTMSKEKLTQVWEAMVLSC
Download sequence
Identical sequences ENSOPRP00000006597 ENSOPRP00000006597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]