SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007375 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007375
Domain Number 1 Region: 22-246
Classification Level Classification E-value
Superfamily L domain-like 8.93e-49
Family Ngr ectodomain-like 0.0068
Further Details:      
 
Domain Number 2 Region: 260-431
Classification Level Classification E-value
Superfamily L domain-like 5.78e-35
Family Internalin LRR domain 0.022
Further Details:      
 
Domain Number 3 Region: 515-821
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 7.69e-33
Family Rhodopsin-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007375   Gene: ENSOPRG00000008054   Transcript: ENSOPRT00000008062
Sequence length 880
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2462:103401:225354:1 gene:ENSOPRG00000008054 transcript:ENSOPRT00000008062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGDSPLPAGCPPHCACEPDGRMLLRVDCSDLGLSELPSNLSVFTSYLDLSMNNISQLXXX
XXXXXXXXXXXRLAGNALTYIPKGAFAGLHSLKVLMLQNNQLRQVPTEALQNLRSLQSLR
LDANHISYVPPSCFRGLHSLRHLWLDDNDLTEIPVQAFRSLSALQAMTLALNKIHHIPDY
AFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGF
HSNRISIPEKFAGNPSLIIHFYDNPIQFVGRSAFQQLPELRTLTLNGASHITEFPDLTGT
ANLESLTLTGAQISSLPQTVCDQLPNLQVLDLSYNLLEDLPSFSVCQKLQKMDLRHNAIY
EIRSDAFQQLLSLRSLNLAWNKITIIHPKAFSTLPSLIKLDLSSNLLSSFPVTGLHGLTH
LKLTGNNDLQNLISSENFPELKVIEMPYAYQCCAFGMCENVYKISNQWNKGDNGSVDDLH
KKDTGMFQVQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLFGSWLVRIGVWTI
AVLALSCNALVASTVFRSLLYTSSVKLLIGVIATVNMLTGLSSAVLAGVDAFTFGSFAQH
GAWWEKGLGCQVLGFLSIFASESSVFLLTVAALERGCSVKCPANFEMKTPFSNLKAIIWL
CTLLALAVASVPLLGGSEYSASPLCLPLPFGEPSTTGFVVALVLLNSLCFLVMTIAYTKL
YCSLEKGDLENTWDCSMVKHVALLLFANCILYCPVAFLSFSSLLNLTFISPEIIKFILLV
IVPLPACLNTLLYILFNPHFKEDLGRLGKHSPWWTRPKHPSLMSINSDDVEKQSCDSTQA
LVTFTSASIAYDLPSNSASSPAYPMTESCHLSSVAFVPCL
Download sequence
Identical sequences ENSOPRP00000007375 ENSOPRP00000007375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]