SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007433 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007433
Domain Number 1 Region: 1629-1754
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-35
Family Cadherin 0.0014
Further Details:      
 
Domain Number 2 Region: 1087-1209
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-32
Family Cadherin 0.00076
Further Details:      
 
Domain Number 3 Region: 1835-1959
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-31
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 240-361
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-30
Family Cadherin 0.0017
Further Details:      
 
Domain Number 5 Region: 2152-2273
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-27
Family Cadherin 0.0017
Further Details:      
 
Domain Number 6 Region: 463-572
Classification Level Classification E-value
Superfamily Cadherin-like 8.64e-26
Family Cadherin 0.0018
Further Details:      
 
Domain Number 7 Region: 2588-2698
Classification Level Classification E-value
Superfamily Cadherin-like 1.15e-25
Family Cadherin 0.0024
Further Details:      
 
Domain Number 8 Region: 1532-1634
Classification Level Classification E-value
Superfamily Cadherin-like 4.45e-25
Family Cadherin 0.0028
Further Details:      
 
Domain Number 9 Region: 1737-1847
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-24
Family Cadherin 0.0023
Further Details:      
 
Domain Number 10 Region: 560-668
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-23
Family Cadherin 0.00081
Further Details:      
 
Domain Number 11 Region: 2356-2466
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-23
Family Cadherin 0.0017
Further Details:      
 
Domain Number 12 Region: 2691-2796
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 13 Region: 2468-2587
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 14 Region: 1199-1306
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 15 Region: 877-988
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-21
Family Cadherin 0.0054
Further Details:      
 
Domain Number 16 Region: 673-774
Classification Level Classification E-value
Superfamily Cadherin-like 5.37e-20
Family Cadherin 0.0022
Further Details:      
 
Domain Number 17 Region: 133-244
Classification Level Classification E-value
Superfamily Cadherin-like 5e-18
Family Cadherin 0.0036
Further Details:      
 
Domain Number 18 Region: 2263-2368
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-17
Family Cadherin 0.0029
Further Details:      
 
Domain Number 19 Region: 991-1090
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-16
Family Cadherin 0.0018
Further Details:      
 
Domain Number 20 Region: 781-880
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000286
Family Cadherin 0.0042
Further Details:      
 
Domain Number 21 Region: 2058-2153
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000485
Family Cadherin 0.0018
Further Details:      
 
Domain Number 22 Region: 1940-2049
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000141
Family Cadherin 0.0091
Further Details:      
 
Domain Number 23 Region: 1424-1538
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000228
Family Cadherin 0.0011
Further Details:      
 
Domain Number 24 Region: 364-475
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000528
Family Cadherin 0.0083
Further Details:      
 
Domain Number 25 Region: 2793-2863
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000542
Family Cadherin 0.0031
Further Details:      
 
Domain Number 26 Region: 1357-1430
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000104
Family Cadherin 0.0047
Further Details:      
 
Domain Number 27 Region: 46-132
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000114
Family Cadherin 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007433   Gene: ENSOPRG00000008111   Transcript: ENSOPRT00000008124
Sequence length 3290
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4240:481716:502080:-1 gene:ENSOPRG00000008111 transcript:ENSOPRT00000008124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKEPGIALSCPGMKSPRPLFLLSSLLLLLGAWVTGAQGQAGSLDLQIDEEQPAGTLIGD
ISAGLPAGTAAPPMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDRERRDRYRFTAVTPD
GATVEVTVRVADINDHAPAFPQARATLQIPEHTAFGTRYPLEPARDADAGHLGTQGYALS
GDGAGETFRLETRPGPDGAPVPELVITGELDRENHSHYMLQLEAYDGGSPPRRAQALLDV
TLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVYASDADAGANGAITYEINRRQSEGDG
PFSIDAHTGLLRLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMT
VIFLSADGSPRVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYL
VCVVRWLDWEEREDYNQVTATDSGSPPRRAEAAFVLHVSDVSDNAPVLDPQLYRPELPEV
ALGSFVVRETAQDSDQGTNGQVTYSLAPGAHTRWFSIDPTSGIITTAASLDYELEPQPQL
IVVATDGGLPPLASSATVSVALQDVNDNEPQFQKTFYNASLPEGTQPGTCFLQVTATDAD
SGPFGHLSYSLGAGLGASGSPPFRIDARSGNVCTIRTLDRDQGPSSFDFTVTAVDGGGLK
SMVYVKVFVSDENDNPPHFYPREYAASLSAQSTPGTAVMRVRAHDPDQGPHGRLSYHILA
GNSPPLFALDEQTGLLTVAWSLARRANSVVQLEIGAQDGGGLQAEPSARINISIVPGTPT
PPIFEKLQYVFSVAEDVAPGTSVGVIQAHNPPGRLGPVTLALSGGDPKGLFSLDAASGLL
QTFRPLDRELLGPVLELEVRAGSGIPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLLPPT
TAPGTPIYTLRALDPDSGVNSRVTFTLLAGGSGVFTVDPTTGHVRLLGPLGPPGGPAHEL
ELEARDGGSPPRTSHFRLRVVVQDLGTHGLAPRFDSPIYRIDLPSGTTPGTQVLQVQAQA
PDGGPITYHLATDGASSPFGLEPQSGWLWVRAALDREAQELYTLKVIAVSASRAELGQQT
GTATVKVSILNQNDHSPRLSEEPTFLAVAENQPPGTSVGRIFATDRDLGPNGRLTYSLRQ
LSEDSKAFRIQPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHIAVLDLND
NSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSL
HPHSGELLTAASLSRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSTRQAEPPPDLTE
PDPGAPVPVVLTVTAAEGLKPGSLLGSVAPPEPAGVGALTYTLVGGADPEGTFALDAVSG
RLYLARPLDFEAGPAWRALTVRAEGPGGAGARLLRVQVRVQDENEHAPNFAREPLALALP
ENPEPGVALYFRASDPDGPDPNSDVRYRLLRQEPPTPPLRLDARTGALSAPGLDRETTPA
LLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQKPGPAALHVV
ARDPDLGEAARVSYRLAAGGDGHFRLHPNTGALSVVRPLDREQRAEHILTVVASDHGSPP
RSATQLLTISVADVNDEAPAFQQQEYSVLLRENSPPGTSLLTLRATDPDLGANGQVTYGG
VSCESFSLDPDTGVLTTLRALDREEQEEINLTVYARDMGSPPLLTHVTVRVTVEDENDHT
PTFGTSHLSLEVPEGQDPQTLTVFRASDPDVGANGQLQYRILDGDLLGAFVLDLASGEFG
TMRPLDREVEPAFQLRIEARDGGQPALSATLLVTVTVLDANDHAPAFPVPAYNVEVPEDA
PAGTLLLQLQAHDADSGANGRVTYYLGAGAAGAFLLEPSSGELRTATNLDREQCPSYAFS
VTAVDGAAAGPLSTTVPVTITVRDVNDHAPTFPTSPLRLRLPRPGPSPRTPTLPLATLRA
EDRDAGANASILYRLAGTPPPGTTVDSYTGEIRMAHSPGALSPRDRVLFIVATDLGRPAR
SATGVVIVGLQGESERGPRFPRASNEATLRENAPPGTPVASPKAVHAGGSNGPITYSILS
GNEKGTFSIQPGTGAITVRSAEGLDFEASPRLRLVLQAESGGIFAFSVLTLTLQDANDNA
PRFLQPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFQVDPATGT
ITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQPWELRVSED
ALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSVGRYGGRISLMGPLDFEQRDRYHLQ
LLAHDGPHEGHANLTVLVEDVNDNSPTFSQSLYQVTLLEHTPPGSAILSVSATDRDSGAN
GHISYHLASPAEGFSVDPNNGTLFTTVGAVSLGYEGPGVVDVVLEARDHGAPGRAARATV
HVQLQDQNDHSPSFTLPHYRVAVTEDLPPGSTLLTLEATDADGSRTHATVDYSIISGNRG
QVFQLEPRLAEAGEGGGPGPRVLGCLVLLEPLDFESLTQYNLTVAAADRGQPPRSSAVPV
TVTILDVNDNPPVFTRASYRVAIPEDTAVGAELLHVEASDADPGPHGLVRFTLSSGDPAG
LFELDESSGTLRLAHPLDCETQTRHQLVVQAADPAGAHFALAPVTVEVQDVNDHGPAFPL
SLLSTSLAENQPPGTLVTTLHAIDGDAGVFGKLHYSLLEAGPGPEGRDAFALNSSTGELR
ARVPFDYEHTGSFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAPAFHFQVPEGARR
GHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYLRVDSRAPGSGTATSGGGG
RTRREAPRELRLEVVARGPLPGSRSATVPVTVDITHTALGLAPDLNLLLVGAVAASLGVV
VVLALAALVLGLVRARSRKAEAAPGPMSQAAPLASGSLQKLGREPPSPPPSEHLYHQTLP
SYGGPGTGGPYPRGGSLDPSHSSGRGSAEAAEDDEIRMINEFPRVASVASSLAARGPDSG
IQQDADGLSDTSCEPPAPDTWYKGRKAGLLLPGAGATLYREEGPPATATAFLGGCGLSPA
PTGDYGFPADGKPCVAGALTAIVAGEEELRGSYNWDYLLSWCPQFQPLASVFTEIARLKD
EARPCPPAPRIDPPPLITAVAHPGAKSVPPKPASTAATRAIFPPASHRSPISHEGSLSSA
AMSPSFSPSLSPLAARSPVVSPFGVAQGPSTSALSAESGLEPPDDTELHI
Download sequence
Identical sequences ENSOPRP00000007433 ENSOPRP00000007433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]