SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007727 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007727
Domain Number 1 Region: 292-346
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000216
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 2 Region: 92-203
Classification Level Classification E-value
Superfamily PX domain 0.0000000425
Family PX domain 0.0023
Further Details:      
 
Domain Number 3 Region: 893-923
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000401
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007727   Gene: ENSOPRG00000008429   Transcript: ENSOPRT00000008440
Sequence length 947
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2527:4389:111197:-1 gene:ENSOPRG00000008429 transcript:ENSOPRT00000008440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQSSLSGGGGGGGRGQGAPTCPACHKVTPRTETPGHSG
SHSLESALRTSAHSTEEPLPKRPLGKHGKVSVEKVDLKRLSHTQSDRNVDCSFEVLWSDS
SVTSVTKSSCEVTEFVSKLSQLHPEESSEKLLPCLAAPEPFYAERSHMDLTGLRYLSSLP
SHVLKNDHVKKFFSTAAPSPPLPGPSPGNPSLSKVGTMMGVSGRPVCGVAGIPASQSSAQ
HHLPHAASAATSLPHCPHSAGAGSALAYRTQMDTSPAILMPSGLQAPQTQEQNGILDWLR
KLRLHKYYPVFKQLTMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSERRCLNPS
ATPLVTSSGVARVPPTSHVGPVQTGRGSHGSHAAELRVDVEQASHQLPREGSSSEYSSSS
SSPRGVQAREESSDSAEENERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXISPRNALYTASTKVAFPSVSSLPVGPLQAGFCASSNAASSSSLPATSFANMATL
PSCPAPSSSPALASVPENSFYSSGAGGGSSTGNIAASSQGHHHHHHHQQPPAPPQPAPPP
PGCIVCTSCGCSGSCGSSGLTVSYANYFQHPFSGPSVFTLPFLPFSPVCSNGYVGAQQYG
GGSAFPVVHAPYSSSVPTEPVLGGQSTFAVPPMQNFMAGPAGMYQAQGLVGGSNGSSHKK
SGNLSCYNCGATGHRAQDCKQPSMDFNRQGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences ENSOPRP00000007727 ENSOPRP00000007727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]