SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007956 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007956
Domain Number 1 Region: 63-189
Classification Level Classification E-value
Superfamily Lysozyme-like 2.95e-47
Family C-type lysozyme 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007956   Gene: ENSOPRG00000008694   Transcript: ENSOPRT00000008691
Sequence length 191
Comment pep:novel genescaffold:pika:GeneScaffold_1570:58076:78553:1 gene:ENSOPRG00000008694 transcript:ENSOPRT00000008691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLETPGNCQSLSKCSKPSAGPPEQSVSAAIPRGLSSWFLQQLRMKAVAVLALACCLATII
ESKVYTRCKLAKIFSRAGLDNYEGFSLGNWICMAYYESHYNTTAQTVLEDGSIDYGIFQI
NSYTWCRRGKTQEKNLCHVACSALLTDDLTDAIICAKRIIKDTQGMNYWQSWKKHCEGRE
LSEWKKGCEVS
Download sequence
Identical sequences ENSOPRP00000007956 ENSOPRP00000007956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]