SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008610 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008610
Domain Number 1 Region: 94-144
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000021
Family C-type lectin domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008610   Gene: ENSOPRG00000009423   Transcript: ENSOPRT00000009408
Sequence length 146
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4090:1700:5911:-1 gene:ENSOPRG00000009423 transcript:ENSOPRT00000009408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDEDGYMALNIKAPEPAVASDVPAASSWWRVMALTLLILCMWMVIGLVALGIIXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHKCSPCETNWRYHGDGCYGFFMHN
VTWEEGKQFCANVNATLLKITSRNML
Download sequence
Identical sequences ENSOPRP00000008610 ENSOPRP00000008610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]