SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008618 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008618
Domain Number 1 Region: 59-177
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-20
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 737-846
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-19
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 3 Region: 420-585
Classification Level Classification E-value
Superfamily Kelch motif 3.01e-16
Family Kelch motif 0.017
Further Details:      
 
Domain Number 4 Region: 983-1027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000544
Family Laminin-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008618   Gene: ENSOPRG00000009389   Transcript: ENSOPRT00000009416
Sequence length 1348
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_671:829970:1540955:1 gene:ENSOPRG00000009389 transcript:ENSOPRT00000009416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSWLLLDGNSWLLCYGFLYLALYAQVSQYKPCERTGSCFSGRCVNSTCLCDPGWVGDQCQ
HCQGRFKLTEPSGYLTDGPINYKYKTKCTWLIEGYPNAVLRLRFNHFATECSWDHMYVYD
GDSIYAPLIAVLSGLIVPEVRGNETVPEVVTTSGYALLHFFSDAAYNLTGFNIFYSXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXGPLQRYGHSLALYQXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS
NTWLVPETKGAIVQGGYGHTSVYDEITKSIYVHGGYKALPGNKYGLVDDLYKYEVNTKTW
TILRESGFARYLHSAVLINGAMLIFGGNTHNDTSLSNGAKCFSADFLAYDIXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXSMYIFGGFSSVLLSDILVYKPPNCKAFRDEELCKNAGPGI
KCVWNKNHCESWESGNTNNILRAKCPPKTAASDDRCYRYADCASCTANTNGCQWCDDKKC
ISANSNCSMSVKNYTKCHVRNEQICNKLTSCKSCSLNLNCQWDQRQQECQALPXXXXXXX
XXXXXXXXXXXXXXXXXYDNAKLYCYNLSGNLASLTTSKEVEFVLDEIQKYTQQKVAPWV
GLRKINISYWGWEDMSPFTNTTLQWLPGEPNDSGFCAYLERAAVAGLKANPCTSMADGLV
CEKPVVSPNQNARPCKKPCSLRTSCSNCTSSGLECMWCSSTKRCVDSNAYIISFPYGQCL
EWQTATCSPQNCSGLRTCGQCLEQPGCGWCNDPSNTGRGHCIEGSSRGPMKFVGMHSSEM
VLDTSLCPKEKNYEWSFIQCPACQCNGHSTCINTNVCEQCKNLTTGKQCQDCMPGYYGDP
TNGGQCTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCDSENRYVGNPLRGTCYXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTISG
EETPIVSKANIKEYRDSFSYEKFNFRNNPNITFYVYVSNFSWPIKIQIAFSQHNTIMDLV
QFFVTFFXXXXXXXXXXXXVWKIKQTCWASRRREQLLRERQQMASRPFASVDVALEVGAE
QTDFPRGPLEGAPKPIAMEPCAGNRAAVLTVFLCLPRGSSGAPPPGQSGLAIASALIDIS
QQRPSESKDKSSGVRNRKHLSTRQGTCV
Download sequence
Identical sequences ENSOPRP00000008618 ENSOPRP00000008618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]