SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009150 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009150
Domain Number 1 Region: 143-249
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-23
Family Cadherin 0.00025
Further Details:      
 
Domain Number 2 Region: 250-364
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-22
Family Cadherin 0.00098
Further Details:      
 
Domain Number 3 Region: 366-478
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-19
Family Cadherin 0.004
Further Details:      
 
Domain Number 4 Region: 472-576
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-19
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 72-150
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000799
Family Cadherin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009150   Gene: ENSOPRG00000010009   Transcript: ENSOPRT00000010014
Sequence length 784
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4414:366329:384075:1 gene:ENSOPRG00000010009 transcript:ENSOPRT00000010014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQWLMMLLSALGACLSLLTVAAAMTGADPAQLDTPSLLLSHRRQKRAWIWNQMHIQEEQN
ASLPHYVGKIKSSVNSKKAKYVLQGDSVGKVFQVDSESGTVSAFERLDREKVSEYHLVAL
IVDKDTNKDLESPSSFTIKVDDVNDNWPVFSRRLFNASVPEMSAVGTSVTRVTAVDADDP
TVADHASVLYQVLKGDEYFGIDNSGLIYTTTKNLDRETQAKYEVVVEARDGQGLRGESGT
TTVLINLQDVNDNFPIFSQAKYTYTVPEDVRVGSPVGSLSVDDPDEPQNRMTKYSIVQGE
YRDTFTIEADPTRNEGIIKLMKPLDYELIRQYRFTIEATDPTINLRYLSHLKKNKAQVII
NITDVDEPPVFQQPFYHFMLQENQKKPLVGSVLAMDPDRPQRNIGYSIRRTSDKGQFFRI
TKQGNIYNEKELDRETHPWYNLTVEAKELDSRGNPTGKESIVRVHVEVLDENDNAPEFAQ
PYEPKVCENTAPGKLVVQISAIDKDITPQNVKFKFALSTQDSNFTLTDNYDNTANVTVKY
GQFDREQAKVHFLPVVISDNGRPSLTGTSTLAVTVCKCNEYGEFTFCEEAAGQTGVSIQA
LVAIFLCILTITVITLLIILRRRLRKQARAHGKNVPEIHEQLVTYDEEGGGEMDTTSYDV
SVLNSVRHGGAKPPRTALDARPSQYAQVQKPPRHLPGAHSGGPGEMAAMIEVKKDEADQD
GGGPPYDTLHIYGYEGSESIAESLSSLGTGSSDSDVDYDFLNDWGPRFKMLAELYSDPPE
EQWY
Download sequence
Identical sequences ENSOPRP00000009150 ENSOPRP00000009150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]