SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009221 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009221
Domain Number 1 Region: 44-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-38
Family SCAN domain 0.0000629
Further Details:      
 
Domain Number 2 Region: 582-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-22
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 3 Region: 353-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.71e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 533-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.91e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 398-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-16
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 767-819
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 628-680
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000305
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 8 Region: 702-748
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000487
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009221   Gene: ENSOPRG00000010079   Transcript: ENSOPRT00000010092
Sequence length 835
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4899:817:18547:1 gene:ENSOPRG00000010079 transcript:ENSOPRT00000010092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMTEPQGVIDLDTPAETSREQEDLLIVKVEEEDCTWMRECSPPASETFYQRFRHFRYQE
ASGPREALSQLRVLCCEWLRPELHTKEQILELLVLEQFLTILPEEFQAWVREHHPESGEE
AVAVVESIQTELEERRQQIVACPEVLPQKMVPPEAVQESFSPQLQSTDSQPEQEPQKPHL
PEDNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXYESRDNVELMVKHISEAESHWXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXERGHRCLDCKFFLQASNFI
PHRRISPGEKPFTCDECGKSYNQRVHLTQHQRVHTGEKPYKCQVCGKAFRVSSHLVQHHS
VHSGERPYGCNECGKNFGRHSHLIEHLKRHFREKSPRCSDKRNKNTRLNVKKISEFSEAD
MELSGKIERNVSQVEDFGDGYDHQGKVDRKPGIPMKDILGPPSSKRVNCSEITYVHKKSS
SGERPHKCNVCGKSFIQSAHLIQHQRIHTGEKPFRCDECGKSYNQRVHLTQHQRVHTGEK
PYTCHLCDKAFRVRSHLVQHQSVHSGERPFKCNECGKGFGRRSHLAGHLRLHSREKSHQC
NECGEVFFQYVSLIEHQVLHMGQKSEKNGICEEASSWNLTVTEDKKIELQEQPYKCDICG
KGFGYSSDLIQHYRTHTAEKTYQCDICRENGQCSHKKQHPKICSSTKSHQCDECGRGFTL
KSHLHQHQRIHTGEKPYQCKECGMSFSWSCSLFKHLRCHERTDSVNTVSVVFLSY
Download sequence
Identical sequences ENSOPRP00000009221 ENSOPRP00000009221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]