SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009890 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009890
Domain Number 1 Region: 147-269
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-24
Family Cadherin 0.00031
Further Details:      
 
Domain Number 2 Region: 372-488
Classification Level Classification E-value
Superfamily Cadherin-like 2e-23
Family Cadherin 0.0053
Further Details:      
 
Domain Number 3 Region: 481-589
Classification Level Classification E-value
Superfamily Cadherin-like 1.41e-16
Family Cadherin 0.0016
Further Details:      
 
Domain Number 4 Region: 261-332
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000003
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 77-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000419
Family Cadherin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009890   Gene: ENSOPRG00000010824   Transcript: ENSOPRT00000010824
Sequence length 790
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1291:368038:448634:1 gene:ENSOPRG00000010824 transcript:ENSOPRT00000010824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTYQYFLLLFWVGQPYPTFSAPLSERTSGFPAKKKALEISGNSKNELNRSKRSWMWNQF
FLLEEYTGSDYQYVGKLHSDQDRGDGSLTYILSGDGAGDLFIINENTGDIQATKSLDREE
KPVYILRAQAINRKTGKPVEPESEFIIKIHDINDNEPIFTKEVYTATVPEMSDVGTFVVQ
VTATDADDPTYGNSAKVVYSILQGQPYFSVXXXXXIIKTALLNMDRENREQYQVVIQAKD
MGGQMGGLSGTTTVNITLTDVNDNPPRFTHGTYEFKTPESSPPGTQIGRIKASDADEGEN
AEIVYSITDEEGLGMFDVITDKETQEGIITVKKXXXXXXXXXXXXXXXXXXXXXXXXXXR
LGPFKDSATVRIMVEDVDEPPVFSKMAYVMQVREDAQVNTTIGSVAAQDPDTTRNPVRYS
VDRHTDMDRIFNIDSGNGSIFTSKLLDRETLLWHNITVIATEINNPKQSSRVPLYIKVLD
VNDNAPEFAEFYETFVCEKAKADQLIQILRAVDKDDPFSGHQFSFSLAPEAAAGSNFTIQ
DNKDNTAGILTRKNGYNRHEMSTYLLPVVISDNDYPVQSSTGTVTVRVCACDHHGNMQSC
HAEALIHPTGLSTGALVAILLCIVILLVTVVLFAALRRQRKKEPLIISKEDIRDNIVSYN
DEGGGEEDTQAFDIGTLRNPEAIEDNKLRRDIVPETLFLPRRTPTARDNTDVRDFINQRL
KENDTDPTAPPYDSLATYAYEGTGSVADSLSSLESVTTDGDQDYDYLSDWGPRFKKLADM
YGGVDSDKDS
Download sequence
Identical sequences ENSOPRP00000009890 ENSOPRP00000009890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]