SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009914 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009914
Domain Number 1 Region: 50-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.57e-34
Family SCAN domain 0.0001
Further Details:      
 
Domain Number 2 Region: 229-289
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-21
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 494-551
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 759-809
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 678-729
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 841-893
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-16
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 979-1031
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000229
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 598-650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000329
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 880-932
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000427
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 10 Region: 444-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000407
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 550-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000162
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009914   Gene: ENSOPRG00000010858   Transcript: ENSOPRT00000010851
Sequence length 1034
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4385:99692:106959:-1 gene:ENSOPRG00000010858 transcript:ENSOPRT00000010851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGRWYTVHPAQAQASRERGRFQVVKKEYEDEGYVSVQPARPQTLNRPGQELFRQLFRQ
LQYHESSGPLETLSRLRELCRWWLRPDVLSKAQMLELLVLEQFLSILPAELRTWVQLHRP
ESGDEAVALLEELQKDSDGTSWRDPGPVQSQDVHWMGTGALRATKLWPPASPLRSGPAPG
DQLEPPYEIGVRDFLAGQSDPHAAQVPSLSQREGSPGDQAKATSSPPAQPQAILTFKDVE
VIFSQDEWALLDSAQRNLYRDVMLENYGNVASLMGPFSKPALISWLESREPWGPNVQEPQ
AKRGPADAPTGSELQIQTDKFILKQEPLEEAETCAVLAVCPVISVSEGTELQESSEPKNR
LNEQCGNVVQVEDKKEETDCSDGYRKEPQILGGGNSGEVKHVTYMPVSKRKQSLRHGCGR
YFRTSSHHYDYKKHGKAHRLMLGSFSLHQRMHTGLKGNEKDLCGKGFSLSSHSQHGQSLH
LARMLYKCGDCGKTFSRSSHLAYHQRHHTQEKPFKCRVCGKAFGWSSNCVRHEKIHTGMK
PYKCSLCEKAFQRLSAYRLHQKTHAKRKFLESKTNPYEEVLNCSMEFAYHLRDQDDERPF
DCNQCRKSFHCKSYVVEHQRIHTQEKPYKCTTCRKTFRWRSNFTRHVRSHREEQLFKQEE
CQEDLRQENYSEPQDAPSGEKTFSCQQCGKTFTRKTTLIDHQRVHTGEKPYQCSDCGKAF
AYRSAFIVHKKKKHNMKRKAESAPTSSQDTVLQVPQGSHTKEEPYKCSQCGKAFRNHSFL
LAHQRVHTREKPYKCRECGKAFRWSSNLYRPHSRHSLKKPYECHEEQKTPTLKPDILTEK
KPFYCQECGKTFTRKRSLLDHKGIHSGEKRYKCNLCGKSYDRNYRLINHQRVHSAERPFK
CQWCGKDFVGRHTLSLHQRKHSRAAQSGCSLPGLSSAQDTGLSMQELKPSGEMPPKDRKE
VGDQSSRHPKLQNLPMEGKCHKCSICGKIFDKHSLLISHKRFHTRERPFKCRECGKTFRW
SSNLARHMKNHIRD
Download sequence
Identical sequences ENSOPRP00000009914 ENSOPRP00000009914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]