SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009934 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009934
Domain Number 1 Region: 37-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.41e-36
Family SCAN domain 0.0000592
Further Details:      
 
Domain Number 2 Region: 407-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.93e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 742-799
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.19e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 799-855
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.01e-23
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 5 Region: 911-967
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 6 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.74e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 855-911
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 630-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.91e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 211-268
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-20
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 10 Region: 463-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.72e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 11 Region: 687-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.23e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 12 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.13e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 13 Region: 366-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-16
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 14 Region: 952-1001
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000261
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009934   Gene: ENSOPRG00000010881   Transcript: ENSOPRT00000010871
Sequence length 1029
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4385:198149:203842:1 gene:ENSOPRG00000010881 transcript:ENSOPRT00000010871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRESWTHSALRQEGLLKGKDETWKWGTSFQGSNASVWETSHLHFRQLRYQETSGPQEAL
SRLRELCRRWLRPEARTKAQILELLVLEQFLSILPVELRTWVQLHRPGSGEEAVALVEEL
QRDLDGPALKVAVPSQDPDPLQEGVNTAGSCLPPGPTGHHMAAQVCPHPRPEPELTSLRG
PPLESPAAEVSALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQRA
LYWDVMLENYGNVTSLEWEAMAENEEETAKPGVTQRADAQKGVCRRLQSSAPQALDSKEE
CEWQALASQWRNEVENSLDPAAEGALCERDQRTRTPPEKRGQGWKGFAENLMSGATIPES
LTGVEGKKFFKCDICLKHFSKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRNH
SGEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRCHSGER
PYKCNECGKVFSQNAYLIDHQRLHKGEEPYKCSKCQKAFILKKSLILHQRIHSGEKPYRC
DECGKTFAQTTYLVDHQRLHSAENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCG
KIFTSKPSLVDHKRMHSREKPYKCAECGKAFTQSAYLFDHQRLHNGEKPYECSDCGKLFI
LRKSLLLHQRLHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECHECGKTFIMSKS
FMVHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECSECGRAFSSNRNLIEH
KRIHSGEKPYECNECGKCFILKKSLIGHQRIHTREKSYKCNDCGKVFSYRSNLTAHQRIH
TGEKPYACSECGKGFTYNRNLLEHQRIHSGEKTYECHICQKVLTSSRNLTVHQRIHTGEK
PYKCNECGKDFSQNKNLVVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKPYGC
NDCSKVFRQRKNLTVHQKTHTDEKPCEYDESEREFCCSSNTHLQQKLHTIEEFSWLQHTS
ESKIKTQKI
Download sequence
Identical sequences ENSOPRP00000009934 ENSOPRP00000009934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]