SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010278 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010278
Domain Number 1 Region: 41-299
Classification Level Classification E-value
Superfamily L domain-like 3.74e-44
Family Ngr ectodomain-like 0.013
Further Details:      
 
Domain Number 2 Region: 294-389
Classification Level Classification E-value
Superfamily Immunoglobulin 4.72e-19
Family I set domains 0.021
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000010278
Domain Number - Region: 471-502
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0423
Family Fibronectin type III 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010278   Gene: ENSOPRG00000011267   Transcript: ENSOPRT00000011260
Sequence length 625
Comment pep:known_by_projection scaffold:pika:scaffold_52153:1058:5229:1 gene:ENSOPRG00000011267 transcript:ENSOPRT00000011260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLPLLLCLLPLAPASSPPQPATPSQCPRRCRCQTQSLPLSVLCPGAGLLFVPPSLDRR
AAELRLADNFIAAVRRRDLANMTGLLHLSLSRNTIRHVAAGAFADLRALRALHLDGNRLT
SLGEGQLRGLVNLRHLILSNNQLAALAAGALDDCAETLEDLDLSYNNLEQLPWEALGRLG
NVNTLGLDHNLLASVPAGAFSRLHKLARLDMTSNRLTTIPPDPLFSRLPLLARPRGSPAS
ALVLAFGGNPLHCNCELVWLRRLAREDDLEACASPPALGGRYFWAVGEEEFVCEPPVVTH
RSPPLAVPAGRPAALRCRAVGDPEPRVRWVSPQGRLLGNSSRARAFPNGTLELLVTEPSD
GGIFTCIAANAAGEATAAVELTVGPPPPPQLANSTSCDPPRDGEPDALTPPSAASASAKV
ADTVSPTDRVQVTEHGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMIPADSHSF
LLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFSTEPALRPCGAPHAPFLGGTMII
ALGGVIVASVLVFIFVLLMRYKVHGGQPPGKAKVAAPVSSVCSQTNGALSPAPSVPAPEP
AAPRAHTVVQLDCEPWGPGHEPTGP
Download sequence
Identical sequences ENSOPRP00000010278 ENSOPRP00000010278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]