SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010287 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010287
Domain Number 1 Region: 7-235
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2e-35
Family G proteins 0.0000659
Further Details:      
 
Domain Number 2 Region: 212-302
Classification Level Classification E-value
Superfamily Translation proteins 9.56e-23
Family Elongation factors 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010287   Gene: ENSOPRG00000011276   Transcript: ENSOPRT00000011270
Sequence length 591
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4778:203720:402807:1 gene:ENSOPRG00000011276 transcript:ENSOPRT00000011270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPRVNVNVGVLGHIDSGKTALARALSTTASTAAFDKQPQSRERGITLDLGFSCFSVPL
PPRLRPALSTHGPEPQSGEPLLQVTLVDCPGHASLIRTIIGGAQIIDLMMLVIDVTKGMQ
TQSAECLVIGQIACQKLVVVLNKIDLLAEEKRQAAIDRMTKKMQKTLENPKFRGAPIIPV
AAKPGGPEAPETEAPQGISELIELLTSQISIPTRDPSGPFLMSVDHCFSIKGQGTVMTGT
ILSGSISLGDSVEIPALKVVKKVKSMQMFHMPVTSAMQGDRLGICVTQFDPKLLERGLVC
APESLHTVHAALISVEKIPYFRGPLQTKAKFHITVGHETVMGRLMFFSPAPDAFDSEPVL
DSFDFSREYLFQEQYLGKDSAGPVADSEEADKKAGPATEGRCPRQQWALVEFEKPVTCPR
LCLVIGSRLDTDIHANTCRLAFHGILLHGLEAKDYAESFLPTLKVFKLKHKHGLVERAMD
DYSVIGRSLFKKETNIQLFVGLKVHLSTGEQGVIDSAFGQSGKFKIHVPGGLSPETKKIL
TAAVKKRGRAGRGETAPQEEGTERPEPTQHVALSLSFKRYVFDTHKRMVQS
Download sequence
Identical sequences ENSOPRP00000010287 ENSOPRP00000010287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]