SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010408 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010408
Domain Number 1 Region: 240-380
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.06e-24
Family DnaQ-like 3'-5' exonuclease 0.0013
Further Details:      
 
Domain Number 2 Region: 519-663
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000364
Family Canonical RBD 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010408   Gene: ENSOPRG00000011398   Transcript: ENSOPRT00000011406
Sequence length 772
Comment pep:novel genescaffold:pika:GeneScaffold_567:135479:171402:1 gene:ENSOPRG00000011398 transcript:ENSOPRT00000011406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPERDRTGRPPRNGRKRKRAPNEPQGVADAMRGHWELEERQSLAKKPRLSTVLFAENCE
ITYGQLFELLKYAVLGKSCVSKPRWCQIIHQKYLKGVVVFVLQGMSQLQFYRFYLEFGYL
GKAFGHKFRLPPPSPNFLADLIGLKQKQPTGDPLKMLEXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCLTSQ
GKELTRVSVVAEGGFCIMDELVKPDNRIVDYLTRFSGITKNTLEPVTTKLKDVQKQLRAL
LPPDAVLVGHSLDLDLRALQMIHPYVIDTSLLYVREQGRRFKLKFLAKAVLGKDIQCPNK
IGHDAIEDARTALELAQYFLKYGPKKIAKLNLQTLVHHQELLAASQEPRNTLEVAQFSNA
SILECLDSLGQKLLFLTQETDASELSSRNCHTVKCLSNKEVFDQARGEILRVPFSXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRYLKRLFKSFGPVQSITIILETY
QPYLCVQYDVLEAAQLAIETLNGIQLEGVCIKVKRPVTELTLDCDKLLDELALDAENQGS
LYLSGVKGDFKERLLQQSNCFLGLEALILPKDHRSGIPKNYCFLKFKNVGSAQRALSIFR
GKDWNLKGRHALTPRHLHTWLRNSPLESSPLGLPVTSLSSEQETLQALNVDHSKLASWRW
GRKIEKLYNSLSPGTLCLILLPGTQSTHGSLTGLGLMGIKGEEESTTSSTCL
Download sequence
Identical sequences ENSOPRP00000010408 ENSOPRP00000010408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]