SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010504 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010504
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.22e-28
Family G proteins 0.012
Further Details:      
 
Domain Number 2 Region: 148-228
Classification Level Classification E-value
Superfamily TGS-like 1.54e-19
Family G domain-linked domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010504   Gene: ENSOPRG00000011524   Transcript: ENSOPRT00000011514
Sequence length 229
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2408:1752:9160:1 gene:ENSOPRG00000011524 transcript:ENSOPRT00000011514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQT
ELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEEL
DIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTV
EDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK
Download sequence
Identical sequences ENSOPRP00000010504 ENSOPRP00000010504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]