SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011045 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011045
Domain Number 1 Region: 147-370
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.42e-59
Family Nuclear receptor ligand-binding domain 0.000000000949
Further Details:      
 
Domain Number 2 Region: 52-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-27
Family Nuclear receptor 0.00000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011045   Gene: ENSOPRG00000012107   Transcript: ENSOPRT00000012101
Sequence length 370
Comment pep:known_by_projection scaffold:pika:scaffold_13961:24399:34384:1 gene:ENSOPRG00000012107 transcript:ENSOPRT00000012101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQKPSKXXXXXXXXXXXARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKA
TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM
AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWALIHVATEAHRSTNA
QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS
ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF
ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI
PHFWPKLLMK
Download sequence
Identical sequences ENSOPRP00000011045 ENSOPRP00000011045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]