SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011159 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011159
Domain Number 1 Region: 125-415
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.1e-57
Family Nuclear receptor ligand-binding domain 0.0000268
Further Details:      
 
Domain Number 2 Region: 51-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000346
Family Nuclear receptor 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011159   Gene: ENSOPRG00000012229   Transcript: ENSOPRT00000012228
Sequence length 419
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_508:162344:192556:1 gene:ENSOPRG00000012229 transcript:ENSOPRT00000012228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRILDIPCKVCGDR
SSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXVQHERGPRTSTIRKQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGL
ELAAVAATPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSIKWAKS
VPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPGDANTLLAVSGMNGDNTDSQKLNKII
SEIQALQEVVARFRQLRLDATEFACLKCIVTFKAGGSELRSFRNAAAIAALQDEAQLTLN
SYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFFKKTIGNVPITRLLSDMYKSSDI
Download sequence
Identical sequences ENSOPRP00000011159 ENSOPRP00000011159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]