SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011694 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011694
Domain Number 1 Region: 146-283
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-28
Family Cadherin 0.0000377
Further Details:      
 
Domain Number 2 Region: 372-499
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-24
Family Cadherin 0.00023
Further Details:      
 
Domain Number 3 Region: 265-377
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-23
Family Cadherin 0.0000216
Further Details:      
 
Domain Number 4 Region: 54-150
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000145
Family Cadherin 0.0000229
Further Details:      
 
Domain Number 5 Region: 485-587
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000171
Family Cadherin 0.0000554
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011694   Gene: ENSOPRG00000012801   Transcript: ENSOPRT00000012804
Sequence length 772
Comment pep:known_by_projection scaffold:pika:scaffold_2554:61070:79188:1 gene:ENSOPRG00000012801 transcript:ENSOPRT00000012804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVAGCPGQELAPLSTGNNFTGQNGGTIQSLQERKASKLSASKRILQRRKREWVVPPISVS
ENGKGPYPQRLNQLKSNKDRGTRIFYSITGPGADSPPEGVFTIEKETGWLLLNKPLDREK
VAKYELFGHAVSENGASVEEPMNISIIVTDQNDHKPKFTLDVFRGSVLEGVLPGTSVMQV
TATDEDDAVNTYNGVVAYSIHSQEPKEPHDLMFTVHRSTGTISVISSGLDREKVPEYTLT
IQATDMDGDGSTTTAVAVVEILDANDNAPVFDPQKYEARVPENAVGHKVQRLTVTDLDVP
NSTAWRAAYRIVGGDDGGHFTITTHPESNQGILTTRKGLDFEAKTQHTLYVEVTNEVPFV
VKLPTATATVVVHVEDVNEAPVFVPPSKIVDVQEGISIGETVCVYTARDPDTKNQKISYH
ILSDPAGWLTVDPDSGQVTAAGILDREDERFVRNNVYEVMILATDNGSPPTTGTGTLLLT
LSDVNDHGPIPEPRKITICNQSPVPQVLNITDKDLSPNSSPFQARLTHDSDIYWTAEVHE
KGDTVALSLKKFLKQDMYDVFLSLSDHGDKEQLTVIRATVCNCHGHVNTCPDPWKGGFVL
PILGAALTLLLLLLVLLLLVRKKRKVKEPLLLPEDDTRDNVFYYGEEGGGEEDQDYDITQ
LHRGLEARPEVVLRNDVAPTFMPTPMYRPRPANPDEIGNFIVENLKAANTDPTAPPYDSL
LVFDYEGSGSDAASLSSLTSSASDQDQDYDYLSEWGSRFKKLADMYGGGEDD
Download sequence
Identical sequences ENSOPRP00000011694 ENSOPRP00000011694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]