SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011727 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011727
Domain Number 1 Region: 183-306
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 3.92e-60
Family Dystroglycan, domain 2 0.000000344
Further Details:      
 
Domain Number 2 Region: 499-600
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-18
Family Dystroglycan, N-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 63-161
Classification Level Classification E-value
Superfamily Cadherin-like 4.55e-17
Family Dystroglycan, N-terminal domain 0.00000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011727   Gene: ENSOPRG00000012836   Transcript: ENSOPRT00000012839
Sequence length 881
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4145:46975:61018:1 gene:ENSOPRG00000012836 transcript:ENSOPRT00000012839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMPVGLPLLFPLWGRTFLLFLLSAAVAQSRWPSDPSEPVRDWENQLEASMHSVLSDLHE
VVPTVVGIPDGTAVVGRSFRVAIPTDLIGSSGDIIKVSAAGKEALPSWLHWDPQSHTLEG
LPLDTDKGVHYISVSAARLGANGSHIPQMASVFSIEVYPEDHNEPQSVRCGASPDPGELA
PSACAADEPVTVLTVILDADLTKMTPKQRLDLLHRMQSFSQVELHHMKLVPVVNNRLFDM
SAFMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVEAPAREGTMSAQLGYPVVGWH
IANKKPPLPKRVRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMVPPV
RDPVPGKPTVTIRTRGAIIQTPTLGPIQPTRVLEAGTTVPGQIRPTMTIPGYVEPTAVAT
PPTTTTKKPRVSTPKPATPSTDSSSTTTRRPTKKPRTSRPVPRVTTKAPSTRLETASPPT
RVRTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDKEDTTTDKLKLTL
KLREQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKR
PQGDKAPARFKAKLAGDPTPVVNDIHKKIALVKKLAFAFGDRNCSTITLQNITHGSIVVE
WTNNTLPQEPCPKEQIAGLSRRIAEDNGQPRPAFSNALEPDFKALSVAVTGSGSCRHLQF
IPVPPPGTPSSVTPLTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKK
RKGKLTLEDQATFIKKGVPIIFADEDDSKPPSSSMLLEERPAPPEYPQSVETAPFDQDTV
KYPLRDDPNAPPYSLTLTCMKGKGSRPKNMTPYRSPPYVPP
Download sequence
Identical sequences ENSOPRP00000011727 ENSOPRP00000011727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]