SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011729 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011729
Domain Number 1 Region: 253-391
Classification Level Classification E-value
Superfamily Cadherin-like 5.37e-32
Family Cadherin 0.0000076
Further Details:      
 
Domain Number 2 Region: 28-176
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-23
Family Cadherin 0.0024
Further Details:      
 
Domain Number 3 Region: 491-618
Classification Level Classification E-value
Superfamily Cadherin-like 3.4e-22
Family Cadherin 0.00024
Further Details:      
 
Domain Number 4 Region: 371-496
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000328
Family Cadherin 0.0000846
Further Details:      
 
Domain Number 5 Region: 166-265
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000971
Family Cadherin 0.00000609
Further Details:      
 
Domain Number 6 Region: 605-705
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000122
Family Cadherin 0.0000686
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011729   Gene: ENSOPRG00000012827   Transcript: ENSOPRT00000012843
Sequence length 898
Comment pep:known_by_projection scaffold:pika:scaffold_2554:97432:159314:1 gene:ENSOPRG00000012827 transcript:ENSOPRT00000012843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLHRSLPWLLLLLLLVSPWLCQEPEPCHPGFGSENYVFTVPRRHLERGRVLGRVSFEG
CTGRPRTAYFSDDSRFQVGTDGVVTVKRPLQLHNPETSFHVHAWDSSYRKLSTRVTLKAV
GRHRNHRHHHSHDSPPGTQPEVLTFPESHHGLRRQKRDWVIPPISCPENEKGPFPKNLVQ
IKSNKDKETQVFYSITGQGADKPPEGVFIIERETGWLKVTEPLDREHIAKYTLFSHAVSS
NGNAVEDPMEIVISVTDQNDNRPEFTRPVFEGSVMEGALPGTSVMQVTATDADDDVNTYN
AAIAYEILSQDPELPHQNMFMINRNTGVISVVATGLDRETYPTYTLVVQAADLQGEGLST
TAVAVITVTDINDNPPIFDPTTYVGQVPENEVNYLVATLKVTDKDAPNTAPWLAQYTILN
DPEGQFEVTTDPVTNDGLLKTAKQRGYPHCSRPCRLGLDFEAKQQYILHVSVQNVVPFEV
ALPTSTATVTVDVMDVNEAPIFMPPEKKVEVPEDFGVGLEITSYTAREPDTFMQQKITYR
IWRDAANWLEINPETGTISTRAEMDREDTNYVKNSTYTAIIIATDNGSPVATGTGTLLLI
LSDVNDNGPVPDPRRMDFCQRDPQPQLINIIDPDLPPNTSPFTAELTHGASVNWTIEYSD
PRQESIILKPKKTLELGDYKINLKLVDNQNKDQVTTLDVLVCDCEGTVNNCMRANYVEAG
LQVPAILGILGGILALLILLLLLLLFVRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEED
QDFDLSQLHRGLDARPEVIRNDVAPTLMSMPQYRPRPANPDEIGNFIDENLKAADTDPTA
PPYDSLLVFDYEGSGSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD
Download sequence
Identical sequences ENSOPRP00000011729 ENSOPRP00000011729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]