SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011829 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011829
Domain Number 1 Region: 562-742
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-61
Family SPRY domain 0.00000654
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily DEATH domain 7.3e-24
Family Pyrin domain, PYD 0.0021
Further Details:      
 
Domain Number 3 Region: 336-399
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000992
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000011829
Domain Number - Region: 264-328
Classification Level Classification E-value
Superfamily RING/U-box 0.00989
Family RING finger domain, C3HC4 0.033
Further Details:      
 
Domain Number - Region: 367-470
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0314
Family Apolipoprotein A-I 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011829   Gene: ENSOPRG00000012953   Transcript: ENSOPRT00000012953
Sequence length 748
Comment pep:known_by_projection scaffold:pika:scaffold_5747:24968:34235:-1 gene:ENSOPRG00000012953 transcript:ENSOPRT00000012953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARTLSDHLLNTLEDLVPYDLEKFKFKLQNINLEKQHSRIPRGQLQMARPVELATLLVTY
YGKEYAVRLTLQVLRAINQRLLAEELRRVTGQEPAESSWEGPEAPSSTVKTAWGLKVAAG
PDSKGQRQAGDSTASLLASQPETGRRSQKKPQGKRRESAPPDAQGKLLGRRSPGLCKPSG
GRPAEVSAQLRRNVSSAGRLQGLVCSPKEQRKADLYLVSGKKRPKSLEFTISSEDKEPSN
PGSLLAGEEIGAGNTTRIAKAAVSLEMNARNPEQKPQGKAACSLCHAQKGDPVGGTCRHG
VCSCSPVPGHLRASGNPLHICLQCQASLAWKNSPELSPQSLPQCQRHMKQVQLLFCEDHR
EPICLICRLSQEHQGHRVRPEEVALEYREQIQQQLERLRQLRQSGEEQRSQGAEQMESLL
KQTETQKQRIRSQVGQLFKFLEHQEQLFVAWLDELGQTISQVREKYGTQVSCDIALLDKL
IGELEAQQCQPEWELVQGIGVTLHRAKAMTVPEPWVTPPEVREKIHLLYRKSEFIEKSMK
YFSETLRSEMETFNVPELIGAQAYAVNMTLDTKTSHPNLIFSDNLKSMRLGNKWDRLPEG
SERFDSCIIALGNPSFLSGRHYWEVEVTDKTTWMLGVCKASVSRKGSMTLSPENGYWVMM
MKQNEYQVSSSPPSRLKMREPPRRVGVFLDYMTRNISFYNVTARSHIYTFTGFSSSGPLQ
AIFSPGGHDGGKNTGPLTICPVSGQRPH
Download sequence
Identical sequences ENSOPRP00000011829 ENSOPRP00000011829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]