SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011832 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011832
Domain Number 1 Region: 1025-1133
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000936
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.028
Further Details:      
 
Domain Number 2 Region: 156-219
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000146
Family ATI-like 0.075
Further Details:      
 
Domain Number 3 Region: 655-704
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000249
Family TSP-1 type 1 repeat 0.00078
Further Details:      
 
Domain Number 4 Region: 302-338
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 378-415
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 261-297
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 338-373
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 771-831
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000196
Family ATI-like 0.092
Further Details:      
 
Domain Number 9 Region: 710-763
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.00073
Further Details:      
 
Domain Number 10 Region: 460-500
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 11 Region: 539-575
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000288
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 12 Region: 867-925
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000902
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000011832
Domain Number - Region: 923-985
Classification Level Classification E-value
Superfamily FnI-like domain 0.000188
Family Fibronectin type I module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011832   Gene: ENSOPRG00000012920   Transcript: ENSOPRT00000012957
Sequence length 1242
Comment pep:novel genescaffold:pika:GeneScaffold_1045:11765:21254:1 gene:ENSOPRG00000012920 transcript:ENSOPRT00000012957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLEGSLVHLLLPGTRVLVQLSPQFRGRVSGLCGDFDGDASNDLRSRQGVLEPTAELAAHS
WRLSPLCPEPGEIPHPCTVNAHRAAWAEARCGVLLQQLFARCHSEVAPQQYYEWCVYDAC
GCDSGGDCECLCSAIATYADECARRGHHVRWRSQELCALQCEGGQVYEACGPTCPATCHG
HQPESEWQCQAVTCVEGCFCPEGTLLHGGSCVEPAACPCEWGGSSFLPGTVLQKDCGNCT
CQESQWHCGGDGARCEELVPGCAEGEAPCQDSGHCVPYEWLCDNQDDCGDGSDEEGCATP
GCTEGQVTCSSGRCLPLALLCDGQDDCGDGTDERGCPCPPDSLACADGRCLPPMLLCDGH
PDCPDAADEESCLGQGDCMPGEVSCADGICVPTFQLCDGVWDCSDGADEGPGHCPLPSLP
MPLPGTLPGPSTLATMLSPLASSSPEDCTSGSDERDCRPPCAPHHVPCAHGLRCVALRQL
CDGVAQCPDGSNESPAACGEALPCAPACASSPLLPGAEDWGGCKRTPPAVPTGSTQLPPC
PGLVPCSSAPWLCLKFSQHCDGTLDCPQGEDEWGCXXXXXXXXXXXXXXPCPEYACPNGS
CIGFQLVSVAVGREGRHGHSCTARAVALLSLQVCDGQPDCASAGEAGLSPEEQGCGAWGP
WGPWGPCSETCGPGVQDRSRPCSPPRAPVLQHCPGPEHESQTCFTVACPVDGKWSSWSPW
SVCSAPCRGTVTRQRQCHPPHNGGQPCALLPGGPHSTHQTKPCSQDDCPNATCSGELVFW
PCAPCPLTCNDLSGQAKCPPDRSCSSPGCWCPKGQVMDNEGRCVWPWQCPCLVDGALYWP
GQRIKANCQLCVCQDGRPQRCRPNPSCAVSCGWSSWSHWAECLGPCGSQSIQWSFRSSTN
PRPSGRGQQCRGIHRKARRCQTEPCEGCEQRGQVHRVGERWRGGPCLVCQCLHNQTIHCS
TYCPLGSCPEGWVLEEGMGESCCHCALPGQNHTLSPMATPAPAPVPSAQIGAPLTTYVLP
SPGDPCYAPLHLAPAPEASLHTSSQPPQRTPWAALLGAPTRGPSTQGQSHGEDTSSEWLT
WPPYLQLDMLQPRNLTGIVISGAGPSNAAASSFSLQLSSDGLHWHDYRDILPGTLPSPKV
PPVPTMQLCHCPSGPPGEQSHGAMLAEDLDASVSWNRETPSMAQARHVKFSNLKEAAIRF
AENFKGSVWSSRGTAPPPWGVHLPPNSLTQTSRAQDLSRLGS
Download sequence
Identical sequences ENSOPRP00000011832 ENSOPRP00000011832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]