SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012197 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012197
Domain Number 1 Region: 276-472
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.61e-45
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0001
Further Details:      
 
Domain Number 2 Region: 116-199
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.23e-16
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000012197
Domain Number - Region: 85-122
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0149
Family Anticodon-binding domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012197   Gene: ENSOPRG00000013361   Transcript: ENSOPRT00000013366
Sequence length 478
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2970:433934:619051:-1 gene:ENSOPRG00000013361 transcript:ENSOPRT00000013366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAAPCLLRTLRCLCSSAPRPRGKARGKLSVRDALRAQPPSGERVKVQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXDLAFGSSVEVHGQLVKSPARKQNVEMKAEHIEVIG
NCDAKAFPIKYKERHPLEYLRQYPHLRCRTNVLGSILRIRSEATAAIHSFFKDNGFVHIH
TPIITSNDCEGAGELFQVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIMEDLFKTSAMTVLSNCPEDVEVCH
RFLAPGHKDRLEHMLKSNFVTISYTEAVEILKKASQNFTFTPEWGADLQTEHEKYLVRHC
GNIPVFVINYPLALKPFYMRDNEDGPQRTVAAVDLLVPGVGELFGGSLREERYHFLEQQL
ARSGLTEAYQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFTHSCLL
Download sequence
Identical sequences ENSOPRP00000012197 ENSOPRP00000012197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]