SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012367 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012367
Domain Number 1 Region: 387-682
Classification Level Classification E-value
Superfamily SIS domain 3.39e-85
Family double-SIS domain 0.00000216
Further Details:      
 
Domain Number 2 Region: 2-209,250-294
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.05e-32
Family Class II glutamine amidotransferases 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012367   Gene: ENSOPRG00000013532   Transcript: ENSOPRT00000013553
Sequence length 682
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_194:131440:180081:-1 gene:ENSOPRG00000013532 transcript:ENSOPRT00000013553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNHEAKERHIQLVKKR
GKVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPNAVNSHPQRSDKGNXXXXXXX
XXXXXXXXXXXXXESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLXX
XXXXXXXXXXXXXXXXXXXRGSPLLIGVRRKYKLSTEQVPIFYRTCTIENVNSTCKARTR
RLDSSTCLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSAS
DDPSRAIQTLQMELQQIMKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXTRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF
ISQSGETADTLLALRYCKDRRALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYT
SQFISLVMFGLMMSEDRISLQGRRQEIIRGLRTLPELIKEVLSLDEKIHDLALELYTQRS
LLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMLIMKDPCF
AKCQNALQQVTARQGRPIILCCKNDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSLH
LAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences ENSOPRP00000012367 ENSOPRP00000012367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]