SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012395 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012395
Domain Number 1 Region: 62-343
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.1e-54
Family Asparaginyl hydroxylase-like 0.079
Further Details:      
 
Domain Number 2 Region: 906-1147
Classification Level Classification E-value
Superfamily RNI-like 3.92e-27
Family Cyclin A/CDK2-associated p19, Skp2 0.041
Further Details:      
 
Domain Number 3 Region: 613-679
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000218
Family PHD domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012395   Gene: ENSOPRG00000013564   Transcript: ENSOPRT00000013585
Sequence length 1159
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4135:24895:127836:1 gene:ENSOPRG00000013564 transcript:ENSOPRT00000013585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLYSPETVRSFGRKRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGK
DFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIE
MTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPTTVDFIDWVDNMWPRHLKES
QTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHN
LELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFL
HSFNIPMQLKIYNIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKEFQKESLS
MDLELNGLESGHGDEDAADREPRRLSSRRSVLTSPVANGVNLDYDGLGKLCRNLPSLKKT
LSGDASSDSARGSHNGQAWDGQCSPRKDRPVHLTHFELEGLRCLVDKLESLPLHKKCVPT
GIEDEDALIADVKVLLEELASSDPKLALTGVPIVQWPKRDKLKFPTRPKVRVPTIPITKP
HTMKAAPRLTPVRPAAASPIASGARRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRM
KQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQMDGEG
LLNEELPNCWECSKCYQEDTSEKAQKRKMEEGDDDTVQAKVLRPLSCDEPLTPPPHSPTM
LQLIHDPASPRGMVTRSSPGAGPSDHHSASRDERFKRRQLLRLQATERTMVREKENNPSG
KKELSEVEKAKIRGSYLTVTLQRPSKELHGTSIVPKLQAITASSANPRHSPRVLVQHCPA
RTPQRGDEEGLGGEEEDEEEEEEDDSAEEGGVARLNGRGSWAQDGDESWMQREVWMSVFR
YLSRRELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLSWTN
ISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIRDLL
TPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQSSN
LLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIANVTLIDLRGCKQITRKACEHFISD
LSINSLYCLSDEKLIQKIS
Download sequence
Identical sequences ENSOPRP00000012395 ENSOPRP00000012395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]