SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012468 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012468
Domain Number 1 Region: 20-181,211-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.36e-68
Family BAR domain 0.00047
Further Details:      
 
Domain Number 2 Region: 265-297,330-387
Classification Level Classification E-value
Superfamily SH3-domain 4.39e-17
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012468   Gene: ENSOPRG00000013664   Transcript: ENSOPRT00000013665
Sequence length 388
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2383:278743:314414:1 gene:ENSOPRG00000013664 transcript:ENSOPRT00000013665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLMDFNVKKLAADAGTFISRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIM
KQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIK
CGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAETRSSQLNSARLEGDNIMXXXXXXXXSEQELRITQSEFDRQAEITRLLLEGISST
HAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLCNNNQTSATPGTSVPSVLS
NVGSSAIASTSGLVISSPSNLNDLKESSGSRKARVLYDYDAANSTELSLLADEVITVFSV
VGMDSDWLMGERGNQKGKVPITYLELLN
Download sequence
Identical sequences ENSOPRP00000012468 ENSOPRP00000012468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]