SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013006 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013006
Domain Number 1 Region: 270-514
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.5e-64
Family G proteins 0.0000000843
Further Details:      
 
Domain Number 2 Region: 592-695
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.03e-31
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00016
Further Details:      
 
Domain Number 3 Region: 496-586
Classification Level Classification E-value
Superfamily Translation proteins 3.74e-21
Family Elongation factors 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013006   Gene: ENSOPRG00000014219   Transcript: ENSOPRT00000014247
Sequence length 699
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_894:36952:61366:-1 gene:ENSOPRG00000014219 transcript:ENSOPRT00000014247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHTRGGLSSRRRRRRRRECRVGTGTAAAATPGCVVSSWSWSLAVFRSARPAPPRAVAPAS
ISRPLSATHTAPPIMDPGSGGGGGGGGGSSSGSSDSGPDCWDQADMEAPGPGPCGGGSLA
AGEVETQRGTFRAFRPHINVNGITFVKVHAAEFVPSFLGGPAASLAPAKNGTGGFREGPF
APVESPQEEQSLCEGSNSAISMELSEPVXXXXXXXXXXXXXXXXXXXXXXXXXQGGGSPG
DGREDSAQEMMEEEEELPKPKSVLATPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGM
VDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAP
GHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLIN
KMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYI
GLPFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHN
VEVLGILSDDVETDSVAPGENLKIRLKGIEEEEILPGFILCDANNLCHSGRTFDAQIVII
EHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTA
GTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD
Download sequence
Identical sequences ENSOPRP00000013006 ENSOPRP00000013006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]