SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013677 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013677
Domain Number 1 Region: 809-999
Classification Level Classification E-value
Superfamily Nucleotide cyclase 2.67e-63
Family Adenylyl and guanylyl cyclase catalytic domain 0.00012
Further Details:      
 
Domain Number 2 Region: 40-427
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.53e-59
Family L-arabinose binding protein-like 0.00062
Further Details:      
 
Domain Number 3 Region: 509-758
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.71e-35
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013677   Gene: ENSOPRG00000014943   Transcript: ENSOPRT00000014978
Sequence length 1072
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_353:9043:76056:-1 gene:ENSOPRG00000014943 transcript:ENSOPRT00000014978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTPLLGLALWSLLVQPSLMFWTTQMSQNCHSGNYEISVLMMNNSAFPESLDNLKDAVIE
GMDIVRQRLREAGLNVTVNATFIYSDGQIHNASDCLSSTCEGFDLLRENTREKRMGCVLM
GPSCTYSTFQMYLDPQLNYPMISAGSFGLSCDYKETLTRMMPPARKLMYFLVNFWKINDL
PFKTFSWDSSYIYKDGTESEDCFWYLNALEAGVSYFSQELSFKDTLRKEDQFRDFLKDHN
RRSNVIIMCGAPSIINSTLKGDWEVTEDTVIILLDLFNSYYFNDTVTAPDYMKNVLVLTL
PPGNFTLNNSFSKDFLPARNDFALAYLDGVLLFGHMLKTFLERDENINTSKFAHAFRNLT
FQGYTRPVTLDGCGDIDTTMMLLYTSVDTRKFKVLLTYDTHMNSTTPVDMSPTFVWKNHK
LPNDIPGRGPQIMLIAIFTLTGTVVLLLLIALLVLRKYKRDNELRQKKWSHIPPENIFPL
ETNETNQVSLTIDDDKRRDTIQRLRQCKYDKKRVILKDLKHSDGNFTEKQKIELNKLLQI
DYYNLTKFYGTVKLDSRIFGVTEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAK
GMSYLHSSKTEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKXXXXXXXXXXXXXXXX
XXXXYSYGIIAQEILRRTFYTQCCRDQNEKIFRVEKPNSLKPFRPDLFLETAEENEMEVY
LLVKNCWEEDPEKRPDFKKIESTLAKIFGLFHDQKSESYMDTLIRRLQLYSRNLEHLVEE
RTQLYKAERDRADRLNFMLLPRLVVISLKEKGIVEPELYENVTIYFSDIVGFTTICKYST
PMEVVDMLNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPMRNGNRHAIDIAKMALEIL
SFMGTFELEHLPGLPIWIRIGIHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLR
IHVNGSTIAILKRTDCQFLYEVRGETYLKGRGTELTYWLTGMKDQEYNLPTPPTVENQQR
LQAEFSDMIASSLQKRQAAGIRSRKPTRVASYKKGTLEYLQLNTTDKESTYF
Download sequence
Identical sequences ENSOPRP00000013677 ENSOPRP00000013677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]