SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013735 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013735
Domain Number 1 Region: 35-169
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-36
Family Phosphotyrosine-binding domain (PTB) 0.00000234
Further Details:      
 
Domain Number 2 Region: 336-439
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-26
Family SH2 domain 0.0000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013735   Gene: ENSOPRG00000015036   Transcript: ENSOPRT00000015041
Sequence length 451
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1087:12848:77455:-1 gene:ENSOPRG00000015036 transcript:ENSOPRT00000015041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHANDQVLGSGVTYVVKXXXXXXXXXXXXXXXXXXXXXXXXEAISRVCEAVPGAKGAFRK
RKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMQSISFASGGDP
DTTDYVAYVAKDPVNRRXXXILECCDGLAQDVIGSIGQAFELRFKQYLQCPSKIPALQDR
MQSLDEPWTEEEAEGSDHPYYNSFPSKMPPPGGFLDARLKTRPQAPDTAHFSGKEQTYYQ
GRHLGDAFGEDWQQTPVRQGSLDIYSTPEGKPQAVPAGDAPTYVNTQRMPTQAPPAVSSS
TESSPRRDLFDMRPFEDALKNQSVGPVLNKAASVECISPVSPQAPDAKMLETLKDEPWYQ
GEMSRKEAEGLLEKDGDFLVRKSTTNSGSFVLTGMHNGQAKHLLLVDPEGTIRTKDRVFD
SISHLINHHLESRVPIVSAGSELSLQQPVER
Download sequence
Identical sequences ENSOPRP00000013735 ENSOPRP00000013735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]