SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013980 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013980
Domain Number 1 Region: 230-361
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-31
Family Cadherin 0.00075
Further Details:      
 
Domain Number 2 Region: 439-566
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-26
Family Cadherin 0.0023
Further Details:      
 
Domain Number 3 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-21
Family Cadherin 0.0046
Further Details:      
 
Domain Number 4 Region: 126-234
Classification Level Classification E-value
Superfamily Cadherin-like 1.02e-19
Family Cadherin 0.005
Further Details:      
 
Domain Number 5 Region: 555-666
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000301
Family Cadherin 0.0037
Further Details:      
 
Domain Number 6 Region: 30-95
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000828
Family Cadherin 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013980   Gene: ENSOPRG00000015312   Transcript: ENSOPRT00000015303
Sequence length 781
Comment pep:known_by_projection scaffold:pika:scaffold_30327:4205:6688:1 gene:ENSOPRG00000015312 transcript:ENSOPRT00000015303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGAQAAAPNRQVLLLCVFLGMSWAGADLLRYSVAEETEKGTSLANLAKDLGLDVGKLS
ARGARIVSDPHLHVVLLNLLTGDLLLNEKLDREELCGSSEPCVLPFQLLLEQPFEIVPAE
LRVTDINDHSPAFPHEEIPLKILESAPPGAAFLLECAQDPDVGTNSLSNYTVSANAYFHV
NVLGDGEGGILPQLILDQVLDREEVSELNVTLTAMDGGSPPRSGTARVRIQVVDINDNAP
EFGQSVYKVQVPENSLTGSVVVAVSARDLDTGSYGEVVYTLFYPTERVLQTFQINSASGH
LLLKAQLDYEAIQTYTLTIKAQDGGGLFGKCTVVVDVTDINDNAPDLIMSSVTSPVPENS
PETVVAVFRIRDRDSGSNGKMVCSIQEDLPFVLKPSVENFYTLVTDGSLDREAKAQYTIT
ITVSDLGTPRLQSQHNVTVHVSDVNDNAPTFSQALYTLFVLENNSPALHIGSVSASDRDA
GANAQITYSLLQPQGPQVDVGALVALDAASGQLFALRALDYETLRAFEFGVRASDGGSPA
LSGEARVRVVLRDANDHAPRVLYPPRNGSAAGACPELVPRGAEAGYLVSKVVAVDGDSGR
NAWLSYELLQATEPGLFGVWAHSGEVRTARPVSERDAPQQRLLVQVRDHGEPPLSASVAL
HVLLVDGFSQPYLPRPDGPAGKAGLGQAEALTVSLVVALAAVSSLFLASVLALVAARLCG
RGGAVPVGSGCGVSVGEGHLFRPLVDVGGAGTLSHSYQYEVCVSGGSGTGEFKFMKPIVP
N
Download sequence
Identical sequences ENSOPRP00000013980 ENSOPRP00000013980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]