SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014028 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014028
Domain Number 1 Region: 98-263
Classification Level Classification E-value
Superfamily C-type lectin-like 4.02e-34
Family C-type lectin domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014028   Gene: ENSOPRG00000015366   Transcript: ENSOPRT00000015358
Sequence length 282
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5227:63444:76376:-1 gene:ENSOPRG00000015366 transcript:ENSOPRT00000015358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAKYRSTSDMWDDDCGTTLSLHSQVSTASRRPEPRPTEPRRTPSSAWRPAALTLLALCL
VLLVGLAALGLVFFQYYQLSDTQQDRLAEKEERLGNLSRETQSLQARNRKLAETLLRVAE
KLCRELYNKTGGHRCSPCPEKWRWHEDRCYQFYTEGRSWQGCKSFCLSENSTMLKINTQE
VLEFAMPQSYSEFFYSYWTGLSRNSSGEAWLWTDGAPFNFQLFEVAIDVTNLRSRDCVTI
LNGKAFSKDCRELRRCACERPAEVVRPESCCRIPGAPDGSDS
Download sequence
Identical sequences ENSOPRP00000014028 ENSOPRP00000014028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]