SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014237 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014237
Domain Number 1 Region: 128-160
Classification Level Classification E-value
Superfamily WW domain 0.000000000801
Family WW domain 0.00029
Further Details:      
 
Domain Number 2 Region: 9-50
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000283
Family HkH motif-containing C2H2 finger 0.016
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000014237
Domain Number - Region: 169-188
Classification Level Classification E-value
Superfamily WW domain 0.00257
Family WW domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014237   Gene: ENSOPRG00000015589   Transcript: ENSOPRT00000015586
Sequence length 376
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1580:9164:90679:1 gene:ENSOPRG00000015589 transcript:ENSOPRT00000015586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEK
ASKEFAAMEEAALKAYQEDLKRLGLESEIPKTSISPVTNTAPPTPTPPSPHQEKKERKKK
KKESSKGRWVEGMTSDGYHYYYDLITGASQWEKPEGFQGNLKKTGEKTVWVEGLSEDGYS
YYYNTETGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXEKKKNSDEGTKPQIQKEKSQPKQNSSIPKEEKPKAQKKPNPYGEWQE
VKEEIKSNEGVDLELPSTENEYVSTSEGDDGEPKVLFKEKTVTSLGVVADGVTPVLKKRR
IENVKSRNLGQRGDDQ
Download sequence
Identical sequences ENSOPRP00000014237 ENSOPRP00000014237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]