SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014332 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014332
Domain Number 1 Region: 227-365
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-29
Family Cadherin 0.00014
Further Details:      
 
Domain Number 2 Region: 457-582
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-20
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 345-461
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000243
Family Cadherin 0.00033
Further Details:      
 
Domain Number 4 Region: 138-239
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000799
Family Cadherin 0.0006
Further Details:      
 
Domain Number 5 Region: 568-668
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000143
Family Cadherin 0.0055
Further Details:      
 
Domain Number 6 Region: 61-151
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000022
Family Cadherin 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014332   Gene: ENSOPRG00000015684   Transcript: ENSOPRT00000015688
Sequence length 827
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2149:104572:152267:-1 gene:ENSOPRG00000015684 transcript:ENSOPRT00000015688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGPQIRAFSSQLWLSLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLNKCLRSADL
IQSSDPDFRVLDDGSVYTARATVLSEERSFIIRLSDIKTGIQKEIPVLLGQQQKVLKKRH
TKETVLRRTKRRWVPLPCSMQENSLGPFPLLLQQVQSDAAQNYTIYYSISGRGVDQEPLN
LFYIERDTGNLYCTRPVDREEYDVFELVAYAYTADGYSADFPLPLPIKVEDENDNHPVFT
KPIYNFKVPESSRIGTEVGVVCATDRDEPDTMHTQLKYSILEQTPKSPGIFSVDPKTGVI
TTKSHSMDREVVDKYTLIMKVQDMDGQFFGLIGTSSCIITIEDSNDNAPTFRQNAYEASV
EENVYNVEILRIPVDDKDLINTANWRANFTILKGNENGYFQITADKTTNDGVLYVVKPLN
YEEDHQVVLEIGVSNEEPFTRDFVARVPTMNRALVTVHIRDQDEGPECSPLTQYVRIKEN
SAVGSKTNGYKAYDPETRNSNGLRYKILHDPRGWVTIDENSGSIITSKALDREVMDPQNY
LSNITVLATDQVGRSCTGTLIVSIEDVNDNAPTIPQDYIIICKSKMEYADILAADPDDAV
NGAPFYFSLESASPDISRIWTLNRVNDTAARLSYQKNAEFQEYLIPITVKDRAGMSATKT
LKVNLCDCTHSSQCFAAPRSGQIELGKWAILAILLGIALLFXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXCSVNGVMMQTANNSSQGFCGTMGSGVRNGGQETIEMLK
GQQTLQSYRGAGHHHTLDSCRGGHVEMDSCRYTYSEWHNFTQPRLGE
Download sequence
Identical sequences ENSOPRP00000014332 ENSOPRP00000014332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]