SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014420 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014420
Domain Number 1 Region: 3-228
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.49e-79
Family Inorganic pyrophosphatase 0.000000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014420   Gene: ENSOPRG00000015784   Transcript: ENSOPRT00000015784
Sequence length 267
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4451:4822:41965:-1 gene:ENSOPRG00000015784 transcript:ENSOPRT00000015784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVA
NLFPYKGYIWNYGAIPQTWEVTGHNYXXXXXXXXXXXXXXXXXXXXVCARGEIIKVKVLG
ILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPEN
EFAFNAEFKDKDFAVDIIKSTHDYWKALVTKKTDGKGISXXXXXXXXXXXXXXXXXXXXX
XXALPPPCESACTVPTDVDKWFHHQKN
Download sequence
Identical sequences ENSOPRP00000014420 ENSOPRP00000014420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]