SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014786 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014786
Domain Number 1 Region: 741-913
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.2e-42
Family Ypt/Rab-GAP domain of gyp1p 0.004
Further Details:      
 
Domain Number 2 Region: 888-1007
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 3 Region: 157-192,231-379
Classification Level Classification E-value
Superfamily PH domain-like 7.26e-31
Family Phosphotyrosine-binding domain (PTB) 0.0067
Further Details:      
 
Domain Number 4 Region: 14-157
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-19
Family Phosphotyrosine-binding domain (PTB) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014786   Gene: ENSOPRG00000016173   Transcript: ENSOPRT00000016184
Sequence length 1122
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3907:102332:235179:1 gene:ENSOPRG00000016173 transcript:ENSOPRT00000016184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARRHIFPNEASVDFGLQLVGSLPVHALTTMPMLPWVVAEVRRLSGQSSKKEPV
NKQVRLCVSPSGLRCEPDPGKSQQWDPLICSSVFECKPQHVHKLIHNSHDPSYFACLIKE
DAAHRQSICYVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFAKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSCSLGSGIPLSDKLRAVLPGGQEPGRRPMRKSFSQPG
LRSLAFRREFQDGGLRSSSFFSSLEERDIENHLLSGHHIVQPTDIEENRTMLFTIGQSEV
YLISPDTKKVALEKNFKEISFCSQGIRHVDHFGFICRESSGGGGGGLHFVCYVFQCANEA
LVDEIMMTLKQAFTVAAVQQTAKAPAQLCEGCPLQGLHKLCERIEGMNSSKTKLELQKHL
TTLTNQEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKEHVHIGEMKQPGHVAAE
NVGSELPSSATRFRLDMLRTKAKRSLTESLESILSRGNKARGLPEHSTGVDLDSSMSSTL
SNSSKEPSLGEKEAPPVPESSFKLLGSSDDLSSDSESHPTEEPVLLSPQQAFRRRANLEP
KANHVGDSGGTPVKTRRHSWRQQIFLRVATPQKAGDSPSRYEDYTELGDLPPRSPLEPVC
EDGPFGPVPEEKKRTSRELRELWRKAILQQILLLRMEKENQKLQASENDLLNKRLKLDYE
EITPCLKEVTAVWEKMLGTPGRAKIKFDMDRMHSAVGQGVPRHHRGEIWKFLAEQFHLKH
PFPSKQQPRDVPYKELLKQLTSQQHAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYS
LLDQEVGYCQGLSFVAGILLLHMSEEEAFRMLKFLMFDMGLRKQYRPDMIILQIQMYQLS
RLLHDYHRDLYNHLEEHEIGPSLYAAPWFLTVFASQFPLGFVARVFDMIFLQGSEVIFKV
ALSLLGSHKPLILQHENLETIVDFIKNTLPNLGLVQMEKTISQVFEMDIAKQLQAYEVEY
HVLQEELIDSSPLSDNQRMDKLEKTNSXXXXXXXXXXXXXXVANSRIQSLEATVEKLLGS
ESKLKQVLLALELERAALLQAMEGLQQVSGGPDPAQLQPTGD
Download sequence
Identical sequences ENSOPRP00000014786 ENSOPRP00000014786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]