SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014971 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014971
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 5.36e-51
Family N-terminal domain of cbl (N-cbl) 0.000000567
Further Details:      
 
Domain Number 2 Region: 199-285
Classification Level Classification E-value
Superfamily SH2 domain 1.93e-48
Family SH2 domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 291-369
Classification Level Classification E-value
Superfamily RING/U-box 7.51e-43
Family RING finger domain, C3HC4 0.00000878
Further Details:      
 
Domain Number 4 Region: 113-198
Classification Level Classification E-value
Superfamily EF-hand 1.92e-38
Family EF-hand modules in multidomain proteins 0.00000543
Further Details:      
 
Domain Number 5 Region: 792-830
Classification Level Classification E-value
Superfamily UBA-like 0.00000536
Family UBA domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014971   Gene: ENSOPRG00000016385   Transcript: ENSOPRT00000016394
Sequence length 843
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1480:729355:883615:1 gene:ENSOPRG00000016385 transcript:ENSOPRT00000016394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKK
TKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKAD
AAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFT
RLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAI
GYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQ
EQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKG
TEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDSLFMMKELAGAKVERPPSPF
SVAPQASLPPVPPRLDLLHPRVSVPSSTSGLGTTSKTASASLHKDKPLPIPPTLRDLPPP
PPPDRPYSGAAETRPQRRPLPCTPSDCPSRDKLPPVPSGRPGDSWLSRPIPKVPVAAPSP
SDPWTGRELTNRHSLPFSLPSQMEPRADVSRLGSTFSLDVSMNVNSSPLAGPECEHPKIK
PSSSANAIYSLAARPLPVPKRPPGEQCESEEDAEYMTPSSRPVRTLEAAQSSRTCDGDQQ
IDSCTYEAMYNIQSQVPSVAENSTLSEGSLVAAPSNPGAEESENEDDGYDVPKPPVPAVL
ARRTLSDISNASSSFGWLSLDGDTTTNFTEGSQVPERPPKPFPRRINSERKAGSCQQAGG
AIATAASATASPQLSSEIENLMSQGYSYQDIQKALVIAHNNIEMAKNILREFVSISSPAH
VAT
Download sequence
Identical sequences ENSOPRP00000014971 ENSOPRP00000014971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]